⊟Summary[edit | edit source]
- pan ID?: SAUPAN002847000
- symbol?: —
- synonym:
- description?: Cro/CI family transcriptional regulator
- Cro/CI family transcriptional regulator
- transcriptional regulator
- Bacteriophage repressor
- CI-like repressor, superantigen-encodingpathogenicity islands SaPI
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 3297457..3297789
- synteny block?: BlockID0020280
- occurrence?: in 15% of 34 strains
⊟Additional information[edit | edit source]
immR : satellite pathogenicity island master transcriptional repressor ImmR [1]
The staphylococcal satellite pathogenicity island ImmA-ImmR-Str' regulatory switch is the functional equivalent of the cip-cI*-cro system from staphylococcal prophage. ImmR maintains the satellite pathogenicity island in the lysogeny phase until it is cleaved by activated ImmA protease. ImmR contains the canonical heptapeptide sequence TIAAHFD recognized by activated ImmA resulting in a processed 82-residue ImmR that is incapable of binding its operator. De-repression of ImmR occurs in three phases: initiation characterized by SIS binding to ImmR, sequestration characterized by ImmA binding to ImmR and proteolysis characterized by ImmA processing of ImmR. Although not experimentally-confirmed, the most likely ImmR operator site sequence is: THGTTCWYR-n2-YRWGAACDA
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| COL | |
| USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
COL MRTNDEIITIIKTSMKEQNMSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKVLGI
USA300_FPR3757 MRTNDEIITIIKTSMKEQNMSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKVLGI
************************************************************
COL KTEYLLGFAEREESTKQDTIAAHLDGDFTEEELIEIRKYAELVRKAHRNQ
USA300_FPR3757 KTEYLLGFAEREESTKQDTIAAHLDGDFTEEELIEIRKYAELVRKAHRNQ
**************************************************
⊟Literature[edit | edit source]
- ↑ Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)