⊟Summary[edit | edit source]
- pan ID?: SAUPAN002844000
- symbol?: —
- synonym:
- description?: pathogenicity island protein
- pathogenicity island protein
- phage protein
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 3296040..3297445
- synteny block?: BlockID0020280
- occurrence?: in 15% of 34 strains
immA (cip) : satellite pathogenicity island ImmR-degrading endopeptidase ImmA [1]
The staphylococcal satellite pathogenicity island ImmA-ImmR-Str' regulatory switch is the functional equivalent of the cip-cI*-cro system from staphylococcal prophage. Initial displacement of ImmR from its operators requires binding by one of the SIS inducers to ImmR. This alone leads to partial induction of both leftward and rightward transcription with further partial-induction due to ImmA sequestration of full-length ImmR and complete induction by ImmA proteolysis of ImmR. ImmA cleaves the master transcriptional repressor ImmR after the second alanine in the heptapeptide sequence: TIAAHFD. This typically creates a new ImmR C-terminus of alanine-82 resulting in full induction of the lytic phase.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| COL | |
| USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
COL MYLYEKMVIENKEIPIDDGKSLGNFEGLYDNGVILINKNLSERRKAEVLYEELAHHKLTY
USA300_FPR3757 MYLYEKMVIENKEIPIDDGKSLGNFEGLYDNGVILINKNLSETRKAEVLYEELAHHKLTY
****************************************** *****************
COL GNILDQSKFNNRKFENYARRHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEA
USA300_FPR3757 GNILDQSKWINRKFENYARRHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEKYILEA
********: ********************************************:*****
COL IEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
USA300_FPR3757 IEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
********************************
- ↑ Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)