Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0895 [new locus tag: SACOL_RS04595 ]
- pan locus tag?: SAUPAN002855000
- symbol: SACOL0895
- pan gene symbol?: —
- synonym:
- product: pathogenicity island protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0895 [new locus tag: SACOL_RS04595 ]
- symbol: SACOL0895
- product: pathogenicity island protein
- replicon: chromosome
- strand: +
- coordinates: 908684..909004
- length: 321
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3236166 NCBI
- RefSeq: YP_185766 NCBI
- BioCyc: see SACOL_RS04595
- MicrobesOnline: 912366 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATTGGGAAATTAAAGATTTAATGTGTGACATTGAAGTGATAAAACAAAAAATTAAT
GATGTAGCTACCAAACATGCTTGGTTTGTTGAAGATAGATTTGTAAAAAATGAATTAGAA
ACAAAACGGGAACATATTAATTTTTCTGCTAGCTATTTAGAACATCGTATACAAAATGAA
CATACAGTTGAGTTATTACATGTGTACTTAAAAGAATTCAGTGAACTTATACAAAAATTT
CATGAAATAGAAAAAGCGTCATCAGAGAACTTTGACGAGGAATCAGATGACGCAAAGAAT
TCAATAAAAGTAGCAGAGTAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0895 [new locus tag: SACOL_RS04595 ]
- symbol: SACOL0895
- description: pathogenicity island protein
- length: 106
- theoretical pI: 4.74214
- theoretical MW: 12694.1
- GRAVY: -0.719811
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI
- PFAM: no clan defined DUF1474; Protein of unknown function (DUF1474) (PF07342; HMM-score: 60.6)and 2 moreEsxAB (CL0352) LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 15.2)no clan defined pP_pnuc_1; Predicted pPIWI-associating nuclease (PF18165; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.759
- Cytoplasmic Membrane Score: 0.0362
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.2039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001983
- TAT(Tat/SPI): 0.000124
- LIPO(Sec/SPII): 0.000359
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKFHEIEKASSENFDEESDDAKNSIKVAE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)