Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
- pan locus tag?: SAUPAN003351000
- symbol: SACOL1133
- pan gene symbol?: rsmD
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
- symbol: SACOL1133
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1142571..1143113
- length: 543
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237639 NCBI
- RefSeq: YP_185997 NCBI
- BioCyc: see SACOL_RS05785
- MicrobesOnline: 912601 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGCGCGTCATTGCAGGTAAACATAAAAGTAAAGCTTTAGAAAGTATGGAAGGCCGTAAT
ACGAGACCAACTATGGATAAAGTTAAAGAAGGTATCTTTAATAGTTTATATGATGTGTCA
GGTATAGGTTTAGATTTATTTGCAGGAAGCGGGGCGCTTGGAATAGAAGCACTCTCTCGA
GGTATGGATAAGGTAATCTTTGTTGATCAAAATTTTAAAGCTGTAAAAGTTATTAAATCA
AATCTTGCGAATTTGGATTTAGAGGCACAATCTGAAGTTTATAAAAATAATGCAGATAGA
GCTTTAAAAGCATTGTCAAAACGTGATATTCAATTTGATGTCATTTTCTTAGATCCACCT
TATAATAAAGGTCTCATTGATAAAGCTTTAAAACTAATTTCAGAGTTTAATTTATTGAAA
GAAAATGGTATCATCGTTTGTGAATTTAGCAATCATGAAGAAATAGATTATCAACCGTTT
AATATGATTAAACGTTACCATTATGGGTTGACAGACACATTGTTATTAGAAAAGGGAGAA
TAG60
120
180
240
300
360
420
480
540
543
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
- symbol: SACOL1133
- description: hypothetical protein
- length: 180
- theoretical pI: 6.80255
- theoretical MW: 20246.2
- GRAVY: -0.253889
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 167.8)and 11 moreProtein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 34)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 33.2)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 30.3)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 27.3)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 26.1)Protein synthesis tRNA and rRNA base modification N2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 24.3)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23)DNA metabolism Restriction/modification type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family (TIGR02987; EC 2.1.1.72; HMM-score: 20.2)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 19.9)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 14.4)Protein synthesis tRNA and rRNA base modification tRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 13.2)
- TheSEED :
- 16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171)
- PFAM: NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 179.5)and 16 moreMTS; Methyltransferase small domain (PF05175; HMM-score: 37.6)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 31.7)MethyltransfD12; D12 class N6 adenine-specific DNA methyltransferase (PF02086; HMM-score: 25.9)TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 25.4)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 23.6)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 21.6)Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 18.7)N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 17)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 16.2)Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 15.8)UPF0020; RMKL-like, methyltransferase domain (PF01170; HMM-score: 15.6)TRM5-TYW2_MTfase; TRM5/TYW2 methyltransferase domain (PF02475; HMM-score: 15.6)RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 14.5)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 13.9)tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 13.3)Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9631
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0362
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00923
- TAT(Tat/SPI): 0.001268
- LIPO(Sec/SPII): 0.000794
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSRGMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPPYNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)