From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
  • pan locus tag?: SAUPAN003351000
  • symbol: SACOL1133
  • pan gene symbol?: rsmD
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
  • symbol: SACOL1133
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1142571..1143113
  • length: 543
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGCGCGTCATTGCAGGTAAACATAAAAGTAAAGCTTTAGAAAGTATGGAAGGCCGTAAT
    ACGAGACCAACTATGGATAAAGTTAAAGAAGGTATCTTTAATAGTTTATATGATGTGTCA
    GGTATAGGTTTAGATTTATTTGCAGGAAGCGGGGCGCTTGGAATAGAAGCACTCTCTCGA
    GGTATGGATAAGGTAATCTTTGTTGATCAAAATTTTAAAGCTGTAAAAGTTATTAAATCA
    AATCTTGCGAATTTGGATTTAGAGGCACAATCTGAAGTTTATAAAAATAATGCAGATAGA
    GCTTTAAAAGCATTGTCAAAACGTGATATTCAATTTGATGTCATTTTCTTAGATCCACCT
    TATAATAAAGGTCTCATTGATAAAGCTTTAAAACTAATTTCAGAGTTTAATTTATTGAAA
    GAAAATGGTATCATCGTTTGTGAATTTAGCAATCATGAAGAAATAGATTATCAACCGTTT
    AATATGATTAAACGTTACCATTATGGGTTGACAGACACATTGTTATTAGAAAAGGGAGAA
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1133 [new locus tag: SACOL_RS05785 ]
  • symbol: SACOL1133
  • description: hypothetical protein
  • length: 180
  • theoretical pI: 6.80255
  • theoretical MW: 20246.2
  • GRAVY: -0.253889

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 167.8)
    and 11 more
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 34)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 33.2)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 30.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 27.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 26.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification N2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 24.3)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23)
    Genetic information processing DNA metabolism Restriction/modification type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family (TIGR02987; EC 2.1.1.72; HMM-score: 20.2)
    Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 19.9)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 14.4)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 13.2)
  • TheSEED  :
    • 16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171)
    CBSS-269801.1.peg.1715  Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)
  • PFAM:
    NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 179.5)
    and 16 more
    MTS; Methyltransferase small domain (PF05175; HMM-score: 37.6)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 31.7)
    MethyltransfD12; D12 class N6 adenine-specific DNA methyltransferase (PF02086; HMM-score: 25.9)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 25.4)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 23.6)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 21.6)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 18.7)
    N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 17)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 16.2)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 15.8)
    UPF0020; RMKL-like, methyltransferase domain (PF01170; HMM-score: 15.6)
    TRM5-TYW2_MTfase; TRM5/TYW2 methyltransferase domain (PF02475; HMM-score: 15.6)
    RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 14.5)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 13.9)
    tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 13.3)
    Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9631
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0362
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00923
    • TAT(Tat/SPI): 0.001268
    • LIPO(Sec/SPII): 0.000794
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRVIAGKHKSKALESMEGRNTRPTMDKVKEGIFNSLYDVSGIGLDLFAGSGALGIEALSRGMDKVIFVDQNFKAVKVIKSNLANLDLEAQSEVYKNNADRALKALSKRDIQFDVIFLDPPYNKGLIDKALKLISEFNLLKENGIIVCEFSNHEEIDYQPFNMIKRYHYGLTDTLLLEKGE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]