From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1134 [new locus tag: SACOL_RS05790 ]
  • pan locus tag?: SAUPAN003352000
  • symbol: coaD
  • pan gene symbol?: coaD
  • synonym:
  • product: phosphopantetheine adenylyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1134 [new locus tag: SACOL_RS05790 ]
  • symbol: coaD
  • product: phosphopantetheine adenylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1143115..1143597
  • length: 483
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGAACATACAATAGCGGTCATTCCGGGTAGTTTTGACCCCATTACTTATGGTCATTTA
    GACATTATTGAGAGAAGTACAGATAGATTTGATGAAATTCATGTCTGTGTTCTTAAAAAT
    AGTAAAAAAGAAGGTACGTTTAGTTTAGAAGAGCGTATGGATTTAATTGAACAATCTGTT
    AAACATTTACCTAATGTCAAGGTTCATCAATTTAGTGGTTTACTAGTCGATTATTGTGAA
    CAAGTAGGAGCTAAAACAATCATACGTGGTTTAAGAGCAGTCAGTGATTTTGAATATGAA
    TTACGCTTAACTTCAATGAATAAAAAGTTGAACAATGAAATTGAAACGTTATATATGATG
    TCTAGTACTAATTATTCATTTATAAGTTCAAGTATTGTTAAAGAAGTTGCAGCTTATCGA
    GCAGATATTTCTGAATTCGTTCCACCTTATGTTGAAAAGGCATTGAAGAAGAAATTTAAG
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    483

Protein[edit | edit source]

Protein Data Bank: 3F3M

General[edit | edit source]

  • locus tag: SACOL1134 [new locus tag: SACOL_RS05790 ]
  • symbol: CoaD
  • description: phosphopantetheine adenylyltransferase
  • length: 160
  • theoretical pI: 6.67902
  • theoretical MW: 18371
  • GRAVY: -0.245

Function[edit | edit source]

  • reaction:
    EC 2.7.7.3?  ExPASy
    Pantetheine-phosphate adenylyltransferase ATP + pantetheine 4'-phosphate = diphosphate + 3'-dephospho-CoA
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A pantetheine-phosphate adenylyltransferase (TIGR01510; EC 2.7.7.3; HMM-score: 207.5)
    and 6 more
    cytidyltransferase-like domain (TIGR00125; HMM-score: 57)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridine nucleotides nicotinate (nicotinamide) nucleotide adenylyltransferase (TIGR00482; EC 2.7.7.18; HMM-score: 39.9)
    Genetic information processing Protein fate Protein modification and repair [citrate (pro-3S)-lyase] ligase (TIGR00124; EC 6.2.1.22; HMM-score: 34.1)
    Metabolism Energy metabolism Fermentation [citrate (pro-3S)-lyase] ligase (TIGR00124; EC 6.2.1.22; HMM-score: 34.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 25.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridine nucleotides nicotinamide-nucleotide adenylyltransferase (TIGR01527; EC 2.7.7.1; HMM-score: 23)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, Pigments Coenzyme A coA-FolK  Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
    and 4 more
    Coenzyme A Biosynthesis  Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
    dcernst CoA Salvage2  Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
    CBSS-269801.1.peg.1715  Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
    CoA Test  Phosphopantetheine adenylyltransferase (EC 2.7.7.3)
  • PFAM:
    HUP (CL0039) CTP_transf_like; Cytidylyltransferase-like (PF01467; HMM-score: 67.6)
    and 1 more
    Citrate_ly_lig; Citrate lyase ligase C-terminal domain (PF08218; HMM-score: 39.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001605
    • TAT(Tat/SPI): 0.000102
    • LIPO(Sec/SPII): 0.000239
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 135 [4]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 1487.87 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]