From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • pan locus tag?: SAUPAN003450000
  • symbol: SACOL1193
  • pan gene symbol?: ftsL
  • synonym:
  • product: cell division protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • symbol: SACOL1193
  • product: cell division protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1197273..1197659
  • length: 387
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGTACCAACCATATGACGAACAAGTTTATAATAGTATACCGAAGCAACAACCACAAACT
    AAGCCCGAAAAGAAGACTGTTTCGAGAAAAGTGGTTGTACAATTAACTAAATTTGAAAAA
    GTTTTATACATAACTTTGATTACTGTAATTGCTATGTTAAGTATTTATATGCTATCTTTA
    AAAATGGATGCGTATGATACGCGAGGAAAGATTGCAGATTTAGATTATAAAATAGATAAA
    CAATCAAGTGAAAACAGTGCTTTACAATCTGAAATCAAAAAGAATTCTTCTTATGAACGC
    ATATACGAAAAGGCTAAGAAACAGGGGATGAGCCTTGAGAACGATAATGTAAAGGTAGTG
    CGTAGTAATGGCGAAGCAAAAAATTAA
    60
    120
    180
    240
    300
    360
    387


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1193 [new locus tag: SACOL_RS06110 ]
  • symbol: SACOL1193
  • description: cell division protein
  • length: 128
  • theoretical pI: 9.84873
  • theoretical MW: 14806.9
  • GRAVY: -0.730469

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 83.7)
  • TheSEED  :
    • Cell division protein FtsL
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Bacterial Cytoskeleton  Cell division protein FtsL
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 54.2)
    and 4 more
    FtsL_2; Bacteriodetes cell division protein (FtsL-like) (PF19579; HMM-score: 20.4)
    no clan defined Tmemb_9; TMEM9 (PF05434; HMM-score: 18)
    GCV_T_C (CL0740) GTP-eEF1A_C; GTP-eEF1A C-terminal domain-like (PF22594; HMM-score: 14.3)
    no clan defined TSC22; TSC-22/dip/bun family (PF01166; HMM-score: 13.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9846
    • Cell wall & surface Score: 0.0007
    • Extracellular Score: 0.0147
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00404
    • TAT(Tat/SPI): 0.000242
    • LIPO(Sec/SPII): 0.001115
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSIYMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLENDNVKVVRSNGEAKN

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: Integral membrane [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]