Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1074 [new locus tag: SAUSA300_RS05825 ]
- pan locus tag?: SAUPAN003450000
- symbol: ftsL
- pan gene symbol?: ftsL
- synonym:
- product: cell division protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1074 [new locus tag: SAUSA300_RS05825 ]
- symbol: ftsL
- product: cell division protein
- replicon: chromosome
- strand: +
- coordinates: 1173439..1173840
- length: 402
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3912819 NCBI
- RefSeq: YP_493771 NCBI
- BioCyc: see SAUSA300_RS05825
- MicrobesOnline: 1292589 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCTGTAGAAAAAGTGTACCAACCATATGACGAACAAGTTTATAATAGTATACCGAAG
CAACAACCACAAACTAAGCCCGAAAAGAAGACTGTTTCGAGAAAAGTGGTTGTACAATTA
ACTAAATTTGAAAAAGTTTTATACATAACTTTGATTACTGTAATTGCTATGTTAAGTATT
TATATGCTATCTTTAAAAATGGATGCGTATGATACGCGAGGAAAGATTGCAGATTTAGAT
TATAAAATAGATAAACAATCAAGTGAAAACAGTGCTTTACAATCTGAAATCAAAAAGAAT
TCTTCTTATGAACGCATATACGAAAAGGCTAAGAAACAGGGGATGAGCCTTGAGAACGAT
AATGTAAAGGTAGTGCGTAGTAATGGCGAAGCAAAAAATTAA60
120
180
240
300
360
402
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1074 [new locus tag: SAUSA300_RS05825 ]
- symbol: FtsL
- description: cell division protein
- length: 133
- theoretical pI: 9.83728
- theoretical MW: 15333.6
- GRAVY: -0.681955
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 83.6)
- TheSEED :
- Cell division protein FtsL
- PFAM: FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 54.1)and 4 moreFtsL_2; Bacteriodetes cell division protein (FtsL-like) (PF19579; HMM-score: 20.2)no clan defined Tmemb_9; TMEM9 (PF05434; HMM-score: 17.9)GCV_T_C (CL0740) GTP-eEF1A_C; GTP-eEF1A C-terminal domain-like (PF22594; HMM-score: 14.2)no clan defined TSC22; TSC-22/dip/bun family (PF01166; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9875
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0118
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00366
- TAT(Tat/SPI): 0.000138
- LIPO(Sec/SPII): 0.003477
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVEKVYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSIYMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLENDNVKVVRSNGEAKN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: mraZ > mraW > ftsL > pbpA
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]