Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1219 [new locus tag: SACOL_RS06245 ]
- pan locus tag?: SAUPAN003488000
- symbol: SACOL1219
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1219 [new locus tag: SACOL_RS06245 ]
- symbol: SACOL1219
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1227981..1228382
- length: 402
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236137 NCBI
- RefSeq: YP_186082 NCBI
- BioCyc: see SACOL_RS06245
- MicrobesOnline: 912687 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGATATTCCAAAAATCACGACATTTTTAATGTTTAATAACCAAGCTGAAGAAGCTGTT
AAACTATACACAAGCTTATTTGAAGATAGTGAGATTATAACAATGGCTAAGTATGGTGAA
AATGGACCTGGTGATCCCGGGACTGTACAACACTCAATATTTACATTAAATGGACAAGTA
TTCATGGCGATTGATGCTAATAGTGGCACAGAATTACCAATGAATCCTGCGATTTCATTA
TTTGTTACAGTAAAAGATACTATTGAAATGGAACGACTATTTAATGGATTAAAAGATGAA
GGTGCCATTTTAATGCCAAAAACGAATATGCCACCATACAGAGAGTTTGCTTGGGTTCAA
GATAAGTTTGGAGTAAGTTTTCAATTAGCATTACCTGAGTAA60
120
180
240
300
360
402
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1219 [new locus tag: SACOL_RS06245 ]
- symbol: SACOL1219
- description: hypothetical protein
- length: 133
- theoretical pI: 4.14219
- theoretical MW: 14859
- GRAVY: -0.0864662
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- PhnB-like protein PA1358
- PFAM: Glyoxalase (CL0104) 3-dmu-9_3-mt; 3-demethylubiquinone-9 3-methyltransferase (PF06983; HMM-score: 134.5)and 1 moreGlyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 15.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009233
- TAT(Tat/SPI): 0.000154
- LIPO(Sec/SPII): 0.000659
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPMNPAISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQDKFGVSFQLALPE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 135 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)