Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1278 [new locus tag: SACOL_RS06525 ]
- pan locus tag?: SAUPAN003559000
- symbol: frr
- pan gene symbol?: frr
- synonym:
- product: ribosome recycling factor
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1278 [new locus tag: SACOL_RS06525 ]
- symbol: frr
- product: ribosome recycling factor
- replicon: chromosome
- strand: +
- coordinates: 1287303..1287857
- length: 555
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238509 NCBI
- RefSeq: YP_186135 NCBI
- BioCyc: see SACOL_RS06525
- MicrobesOnline: 912741 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAGTGACATTATTAATGAAACTAAATCAAGAATGCAAAAATCAATCGAAAGCTTATCA
CGTGAATTAGCTAACATCAGTGCAGGAAGAGCTAATTCAAATTTATTAAACGGCGTAACA
GTTGATTACTATGGTGCACCAACACCTGTACAACAATTAGCAAGCATCAATGTTCCAGAA
GCACGTTTACTTGTTATTTCTCCATACGACAAAACTTCTGTAGCTGACATCGAAAAAGCG
ATAATAGCAGCTAACTTAGGTGTTAACCCAACAAGTGATGGTGAAGTGATACGTATTGCT
GTACCTGCCTTAACAGAAGAACGTAGAAAAGAGCGCGTTAAAGATGTTAAGAAAATTGGT
GAAGAAGCTAAAGTATCTGTTCGAAATATTCGTCGTGATATGAATGATCAGTTGAAAAAA
GATGAAAAAAATGGCGACATTACTGAAGATGAGTTGAGAAGTGGTACTGAAGATGTTCAG
AAAGCAACAGACAATTCAATAAAAGAAATTGATCAAATGATTGCTGATAAAGAAAAAGAT
ATTATGTCAGTATAA60
120
180
240
300
360
420
480
540
555
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1278 [new locus tag: SACOL_RS06525 ]
- symbol: Frr
- description: ribosome recycling factor
- length: 184
- theoretical pI: 4.7658
- theoretical MW: 20352.8
- GRAVY: -0.584783
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors ribosome recycling factor (TIGR00496; HMM-score: 241.4)and 2 moreEnergy metabolism ATP-proton motive force interconversion V-type ATPase, G subunit (TIGR01147; EC 3.6.3.14; HMM-score: 16.8)Mobile and extrachromosomal element functions Prophage functions phage tail tape measure protein, lambda family (TIGR01541; HMM-score: 11.9)
- TheSEED :
- Ribosome recycling factor
- PFAM: no clan defined RRF; Ribosome recycling factor (PF01765; HMM-score: 223.2)and 6 moreRRF_GI; Ribosome recycling factor (PF12614; HMM-score: 19.1)ATP_synthase (CL0255) V-ATPase_G; Vacuolar (H+)-ATPase G subunit (PF03179; HMM-score: 16.5)CDA (CL0109) SNAD2; Secreted Novel AID/APOBEC-like Deaminase 2 (PF18745; HMM-score: 12.1)no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 11.6)Transthyretin (CL0287) DUF2606; Protein of unknown function (DUF2606) (PF10794; HMM-score: 9.4)S5 (CL0329) Topo-VIb_trans; Topoisomerase VI B subunit, transducer (PF09239; HMM-score: 8.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9844
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.0152
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.041488
- TAT(Tat/SPI): 0.019998
- LIPO(Sec/SPII): 0.001671
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDIINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPYDKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTEERRKERVKDVKKIGEEAKVSVRNIRRDMNDQLKKDEKNGDITEDELRSGTEDVQKATDNSIKEIDQMIADKEKDIMSV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 3133 [5]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: tsf > pyrH > frr
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 27.2 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)