From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1424 [new locus tag: SACOL_RS07250 ]
  • pan locus tag?: SAUPAN003798000
  • symbol: SACOL1424
  • pan gene symbol?: pstS
  • synonym:
  • product: phosphate ABC transporter substrate-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1424 [new locus tag: SACOL_RS07250 ]
  • symbol: SACOL1424
  • product: phosphate ABC transporter substrate-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1435136..1436119
  • length: 984
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAAAAAATGGCAATTTGTTGGTACTACAGCTTTAGGTGCAACACTATTATTAGGTGCT
    TGTGGTGGCGGTAATGGTGGCAGTGGTAATAGTGATTTAAAAGGGGAAGCTAAAGGTGAT
    GGCTCATCAACAGTAGCACCAATTGTGGAGAAATTAAATGAAAAATGGGCTCAAGATCAC
    TCGGATGCTAAAATCTCAGCAGGACAAGCTGGTACAGGTGCTGGTTTCCAAAAATTCATT
    GCAGGAGATATCGACTTCGCTGATGCTTCTAGACCAATTAAAGATGAAGAGAAGCAAAAA
    TTACAAGATAAGAATATCAAATACAAAGAATTCAAAATTGCGCAAGATGGTGTAACGGTT
    GCTGTAAATAAAGAAAATGATTTTGTAGATGAATTAGACAAACAGCAATTAAAAGCAATT
    TATTCTGGAAAAGCTAAAACATGGAAAGATGTTAATAGTAAATGGCCAGATAAAAAAATA
    AATGCTGTATCACCAAACTCAAGTCATGGTACTTATGACTTCTTTGAAAATGAAGTAATG
    AATAAAGAAGATATTAAAGCAGAAAAAAATGCTGATACAAATGCTATCGTTTCTTCTGTA
    ACGAAAAACAAAGAGGGAATCGGATACTTTGGATATAACTTCTACGTACAAAATAAAGAT
    AAATTAAAAGAAGTTAAAATCAAAGATGAAAATGGTAAAGCAACAGAGCCTACGAAAAAA
    ACAATTCAAGATAACTCTTATGCATTAAGTAGACCATTATTCATTTATGTAAATGAAAAA
    GCATTGAAAGATAATAAAGTAATGTCAGAATTTATCAAATTCGTCTTAGAAGATAAAGGT
    AAAGCAGCTGAAGAAGCTGGATATGTAGCAGCACCAGAGAAAACATACAAATCACAATTA
    GATGATTTAAAAGCATTTATTGATAAAAATCAAAAATCAGACGACAAGAAATCTGATGAT
    AAAAAGTCTGAAGACAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    984

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1424 [new locus tag: SACOL_RS07250 ]
  • symbol: SACOL1424
  • description: phosphate ABC transporter substrate-binding protein
  • length: 327
  • theoretical pI: 8.71151
  • theoretical MW: 36117.2
  • GRAVY: -0.870031

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Anions phosphate binding protein (TIGR02136; HMM-score: 344.1)
    and 2 more
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, phosphate-binding protein PstS (TIGR00975; HMM-score: 65)
    phosphate ABC transporter substrate-binding protein (TIGR04505; HMM-score: 50.1)
  • TheSEED:  
    Phosphorus Metabolism Phosphorus Metabolism - no subcategory High affinity phosphate transporter and control of PHO regulon  Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)
    and 1 more
    Phosphate metabolism  Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)
  • PFAM:
    PBP (CL0177) PBP_like_2; PBP superfamily domain (PF12849; HMM-score: 137.8)
    and 1 more
    PBP_like; PBP superfamily domain (PF12727; HMM-score: 60.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LLLGACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 20 aa
    • SP(Sec/SPI): 0.000881
    • TAT(Tat/SPI): 0.0001
    • LIPO(Sec/SPII): 0.998765
    • Cleavage Site: CS pos: 20-21. LGA-CG. Pr: 0.9991
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDHSDAKISAGQAGTGAGFQKFIAGDIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYSGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVMNKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAEEAGYVAAPEKTYKSQLDDLKAFIDKNQKSDDKKSDDKKSEDKK

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL1424 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb Drug Resist: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] [DOI] (P p)