From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1489 [new locus tag: SACOL_RS07585 ]
  • pan locus tag?: SAUPAN003909000
  • symbol: recU
  • pan gene symbol?: recU
  • synonym:
  • product: Holliday junction-specific endonuclease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1489 [new locus tag: SACOL_RS07585 ]
  • symbol: recU
  • product: Holliday junction-specific endonuclease
  • replicon: chromosome
  • strand: +
  • coordinates: 1527594..1528220
  • length: 627
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATTATCCAAATGGTAAACCATATCGTAAAAATAGTGCTATAGACGGAGGGAAAAAG
    ACCGCTGCCTTTAGTAATATTGAGTATGGTGGACGTGGTATGTCACTTGAAAAAGATATC
    GAACATTCAAATACGTTTTATCTTAAAAGCGACATTGCAGTTATTCACAAAAAGCCTACG
    CCAGTACAAATAGTTAATGTCAACTATCCTAAGCGGAGTAAAGCTGTGATTAACGAAGCT
    TATTTTCGTACACCTTCAACAACTGATTACAACGGCGTTTATCAAGGTTATTATATTGAT
    TTTGAAGCAAAGGAAACTAAAAACAAGACGTCCTTTCCTTTAAATAATATTCATGACCAT
    CAAGTCGAACATATGAAAAATGCATATCAACAAAAAGGTATTGTGTTTTTAATGATTCGT
    TTTAAAACGCTAGATGAAGTTTATCTTTTACCCTATTCAAAATTCGAAGTATTTTGGAAG
    AGATATAAAGATAATATTAAAAAGTCTATAACAGTTGATGAAATACGAAAAAATGGTTAC
    CATATTCCTTATCAGTATCAACCAAGATTAGACTATCTAAAAGCAGTTGATAAGTTGATA
    TTAGATGAAAGTGAGGACCGCGTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1489 [new locus tag: SACOL_RS07585 ]
  • symbol: RecU
  • description: Holliday junction-specific endonuclease
  • length: 208
  • theoretical pI: 9.7137
  • theoretical MW: 24443.6
  • GRAVY: -0.771635

Function[edit | edit source]

  • reaction:
    EC 3.1.22.-?  ExPASy
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair recombination protein U (TIGR00648; EC 3.1.-.-; HMM-score: 310.5)
  • TheSEED:  
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Control of cell elongation - division cycle in Bacilli  RecU Holliday junction resolvase
  • PFAM:
    PDDEXK (CL0236) RecU; Recombination protein U (PF03838; HMM-score: 221.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.015091
    • TAT(Tat/SPI): 0.000939
    • LIPO(Sec/SPII): 0.002201
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

M G Pinho, H de Lencastre, A Tomasz
Transcriptional analysis of the Staphylococcus aureus penicillin binding protein 2 gene.
J Bacteriol: 1998, 180(23);6077-81
[PubMed:9829914] [WorldCat.org] (P p)