From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
  • pan locus tag?: SAUPAN004248000
  • symbol: ruvA
  • pan gene symbol?: ruvA
  • synonym:
  • product: Holliday junction DNA helicase RuvA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
  • symbol: ruvA
  • product: Holliday junction DNA helicase RuvA
  • replicon: chromosome
  • strand: -
  • coordinates: 1729800..1730402
  • length: 603
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTACGCGTATGTCAAAGGTAAGTTAACACATTTATATCCTACACACGTAGTTGTTGAA
    ACTGCTGGTGTTGGTTATGAAATTCAAACACCAAATTCTTATCGTTTTCAAAAGCATCTA
    GATCATGAAGTTTTAATTCATACATCTTTAATTGTTCGTGAAGATGCACAATTATTGTAT
    GGATTTAGTAGTGAAGAAGAGAAAGATATGTTCTTGAGTTTAATTAAAGTTACTGGTATT
    GGTCCGAAATCAGCTTTAGCTATTTTAGCGACAAGTACGCCTAATGAAGTAAAACGTGCC
    ATTGAAAATGAAAATGATACGTATTTAACTAAATTCCCAGGAATTGGTAAGAAAACGGCA
    AGACAGATTGTCTTAGATTTAAAAGGTAAAGTGAAAATTACTGAAGAAGATAGCGATTCA
    TTATTACAAGTAGACGCTACTTCGACGGTGCAAGATCAATTCGTGCAAGAAGCAATGTTA
    GCGTTAGAAGCATTAGGTTATTCTAAACGAGAGCTTGCAAAAGTTGAGAAAACGTTAAAT
    AAAAATAAATATGACTCAGTTGATGAAGCTGTTAAGGCAGGTCTTCAATTAGTTGTATCT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1697 [new locus tag: SACOL_RS08655 ]
  • symbol: RuvA
  • description: Holliday junction DNA helicase RuvA
  • length: 200
  • theoretical pI: 6.03453
  • theoretical MW: 22262.3
  • GRAVY: -0.246

Function[edit | edit source]

  • reaction:
    EC 3.6.4.12?  ExPASy
    DNA helicase ATP + H2O = ADP + phosphate
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 174)
    and 3 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS13 (TIGR03631; HMM-score: 16.1)
    Unknown function Enzymes of unknown specificity putative DNA modification/repair radical SAM protein (TIGR03916; HMM-score: 13.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair recombination protein RecR (TIGR00615; HMM-score: 12.3)
  • TheSEED:  
    DNA Metabolism DNA recombination RuvABC plus a hypothetical  Holliday junction DNA helicase RuvA
    and 1 more
    DNA replication DNA-replication  Holliday junction DNA helicase RuvA
  • PFAM:
    OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 73.2)
    and 11 more
    HHH (CL0198) HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 55)
    UBA (CL0214) RuvA_C; RuvA, C-terminal domain (PF07499; HMM-score: 39.1)
    HHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 27.5)
    IMS_HHH; IMS family HHH motif (PF11798; HMM-score: 23.6)
    H2TH (CL0303) Ribosomal_S13; Ribosomal protein S13/S18 (PF00416; HMM-score: 20.6)
    HHH (CL0198) HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 17.8)
    HHH_3; Helix-hairpin-helix motif (PF12836; HMM-score: 16.2)
    5_3_exonuc_C (CL0464) 5_3_exonuc; 5'-3' exonuclease, C-terminal SAM fold (PF01367; HMM-score: 13.3)
    HHH (CL0198) HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 13.3)
    HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 12.9)
    DNA_pol_lambd_f; Fingers domain of DNA polymerase lambda (PF10391; HMM-score: 12)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003512
    • TAT(Tat/SPI): 0.000142
    • LIPO(Sec/SPII): 0.001493
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLYGFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTARQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLNKNKYDSVDEAVKAGLQLVVS

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 103 [4]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 35.6 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]