Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
- pan locus tag?: SAUPAN004258000
- symbol: SACOL1705
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
- symbol: SACOL1705
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1735393..1735866
- length: 474
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238504 NCBI
- RefSeq: YP_186544 NCBI
- BioCyc: see SACOL_RS08700
- MicrobesOnline: 913153 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGATTGATATTTAGTATGATTAAAAACATTATAGCAGTAATAGCAATTGTGATAATT
GTTTATATCGCCTTGAAATACGCACCTTTTTTAAAAGAACAAGATTGGAATCCTGTAAAT
CACGATAATGATCAAATGAATCAAGTTACGCAACCCACTAATGATGCCCAACATGTTTAT
GTAAGTGGTGAGAAATATTCATTAAAAGAAAATGATTTAATAAAGAATGTACCATTAAGC
CAAATTAAAAATGTATTTAAAATGATAGATAAACAAGAGTTTATGGCTGTGTCTGGAATG
AATCGCATGGCTTATAATGATCAATATATTATAGGTCAAAGAGGAGACGAATTTATTCTT
TATAAATTTGGAGATGAGTCAATGCGTGTTTACAATACTGAATTTGAAATGCAACAAGAC
TTAAATGAATTAGGGCAAAATTTACAACTAAAATCTGAAAATGCTTATCAATAG60
120
180
240
300
360
420
474
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
- symbol: SACOL1705
- description: hypothetical protein
- length: 157
- theoretical pI: 4.76604
- theoretical MW: 18384.9
- GRAVY: -0.390446
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108101: hypothetical protein
- PFAM: no clan defined DUF4930; Domain of unknown function (DUF4930) (PF16284; HMM-score: 264.9)and 3 moreTrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 14.2)no clan defined Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 13.3)DUF3975; Protein of unknown function (DUF3975) (PF13126; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.929
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0703
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 3
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.222384
- TAT(Tat/SPI): 0.000427
- LIPO(Sec/SPII): 0.012959
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRLIFSMIKNIIAVIAIVIIVYIALKYAPFLKEQDWNPVNHDNDQMNQVTQPTNDAQHVYVSGEKYSLKENDLIKNVPLSQIKNVFKMIDKQEFMAVSGMNRMAYNDQYIIGQRGDEFILYKFGDESMRVYNTEFEMQQDLNELGQNLQLKSENAYQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Signal peptide containing [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)