From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
  • pan locus tag?: SAUPAN004258000
  • symbol: SACOL1705
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
  • symbol: SACOL1705
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1735393..1735866
  • length: 474
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGATTGATATTTAGTATGATTAAAAACATTATAGCAGTAATAGCAATTGTGATAATT
    GTTTATATCGCCTTGAAATACGCACCTTTTTTAAAAGAACAAGATTGGAATCCTGTAAAT
    CACGATAATGATCAAATGAATCAAGTTACGCAACCCACTAATGATGCCCAACATGTTTAT
    GTAAGTGGTGAGAAATATTCATTAAAAGAAAATGATTTAATAAAGAATGTACCATTAAGC
    CAAATTAAAAATGTATTTAAAATGATAGATAAACAAGAGTTTATGGCTGTGTCTGGAATG
    AATCGCATGGCTTATAATGATCAATATATTATAGGTCAAAGAGGAGACGAATTTATTCTT
    TATAAATTTGGAGATGAGTCAATGCGTGTTTACAATACTGAATTTGAAATGCAACAAGAC
    TTAAATGAATTAGGGCAAAATTTACAACTAAAATCTGAAAATGCTTATCAATAG
    60
    120
    180
    240
    300
    360
    420
    474

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1705 [new locus tag: SACOL_RS08700 ]
  • symbol: SACOL1705
  • description: hypothetical protein
  • length: 157
  • theoretical pI: 4.76604
  • theoretical MW: 18384.9
  • GRAVY: -0.390446

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108101: hypothetical protein
  • PFAM:
    no clan defined DUF4930; Domain of unknown function (DUF4930) (PF16284; HMM-score: 264.9)
    and 3 more
    TrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 14.2)
    no clan defined Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 13.3)
    DUF3975; Protein of unknown function (DUF3975) (PF13126; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0003
    • Cytoplasmic Membrane Score: 0.929
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0703
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 3
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.222384
    • TAT(Tat/SPI): 0.000427
    • LIPO(Sec/SPII): 0.012959
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRLIFSMIKNIIAVIAIVIIVYIALKYAPFLKEQDWNPVNHDNDQMNQVTQPTNDAQHVYVSGEKYSLKENDLIKNVPLSQIKNVFKMIDKQEFMAVSGMNRMAYNDQYIIGQRGDEFILYKFGDESMRVYNTEFEMQQDLNELGQNLQLKSENAYQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: VraR (activation) regulon
    VraR(TF)response regulator important for resistance against cell-wall targeting antibiotics;  [4] [5]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Makoto Kuroda, Hiroko Kuroda, Taku Oshima, Fumihiko Takeuchi, Hirotada Mori, Keiichi Hiramatsu
    Two-component system VraSR positively modulates the regulation of cell-wall biosynthesis pathway in Staphylococcus aureus.
    Mol Microbiol: 2003, 49(3);807-21
    [PubMed:12864861] [WorldCat.org] [DOI] (P p)
  5. Susan Boyle-Vavra, Shouhui Yin, Dae Sun Jo, Christopher P Montgomery, Robert S Daum
    VraT/YvqF is required for methicillin resistance and activation of the VraSR regulon in Staphylococcus aureus.
    Antimicrob Agents Chemother: 2013, 57(1);83-95
    [PubMed:23070169] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]