Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
- pan locus tag?: SAUPAN004260000
- symbol: SACOL1706
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
- symbol: SACOL1706
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1736340..1736624
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238572 NCBI
- RefSeq: YP_186545 NCBI
- BioCyc: see SACOL_RS08710
- MicrobesOnline: 913154 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGACTCTATTTATTATTATCGGGGTTCTCGTGCCAATGGTTTATACCATGCAGTTAAAT
ATTAAAAATGAACCTGTAACAAAGCGCAATCTTTTAATAACATTAGCTTTATCTACGTTA
GGTATTTTAGTAACCGCGTTAGCAGGTGTAATCGTTACGAAACAAGCTTTTCCTTTATTA
AGTGTAGCAATTGGCTCAATTTTTACTGGAATCGTTTGGGGCCTTTTACTAAGTGGTAGC
TACGCGCTGATACGATTTTTATCTAACGCATTTGGGCGTAAGTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
- symbol: SACOL1706
- description: hypothetical protein
- length: 94
- theoretical pI: 11.2593
- theoretical MW: 10120.3
- GRAVY: 1.15638
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108281: hypothetical protein
- PFAM: Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 14.8)no clan defined DUF6343; Family of unknown function (DUF6343) (PF19870; HMM-score: 12.8)DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 12.2)and 3 moreTssN; Type VI secretion system, TssN (PF17555; HMM-score: 9.6)GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 8.4)no clan defined DUF3481; C-terminal domain of neuropilin glycoprotein (PF11980; HMM-score: 7.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0005
- Cytoplasmic Membrane Score: 0.9828
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0166
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025897
- TAT(Tat/SPI): 0.001093
- LIPO(Sec/SPII): 0.028258
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLFIIIGVLVPMVYTMQLNIKNEPVTKRNLLITLALSTLGILVTALAGVIVTKQAFPLLSVAIGSIFTGIVWGLLLSGSYALIRFLSNAFGRK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)