Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
- pan locus tag?: SAUPAN004448000
- symbol: rot
- pan gene symbol?: rot
- synonym:
- product: repressor of toxins
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
- symbol: rot
- product: repressor of toxins
- replicon: chromosome
- strand: -
- coordinates: 1868445..1868945
- length: 501
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238705 NCBI
- RefSeq: YP_186645 NCBI
- BioCyc: see SACOL_RS09285
- MicrobesOnline: 913256 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGCATAAGTTAGCACATACAAGTTTTGGGATTGTTGGGATGTTTGTTAATACTTGTATA
GTAGCTAAATATGTGATTATTAATTGGGAGATGTTTAGCATGAAAAAAGTAAATAACGAC
ACTGTATTTGGAATTTTGCAATTAGAAACACTTTTGGGTGACATTAACTCAATTTTCAGC
GAGATTGAAAGCGAATACAAAATGTCTAGAGAAGAAATTTTAATTTTACTAACTTTATGG
CAAAAAGGTTTTATGACGCTTAAAGAAATGGACAGATTTGTTGAAGTTAAACCGTATAAG
CGTACGAGAACGTATAATAATTTAGTTGAATTAGAATGGATTTACAAAGAGCGTCCTGTT
GACGATGAAAGAACAGTTATTATTCATTTCAATGAAAAGTTACAACAAGAGAAAGTAGAG
TTGTTGAATTTCATCAGTGATGCGATTGCAAGTAGAGCAACAGCAATGCAAAATAGTTTA
AACGCAATTATTGCTGTGTAA60
120
180
240
300
360
420
480
501
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
- symbol: Rot
- description: repressor of toxins
- length: 166
- theoretical pI: 5.7418
- theoretical MW: 19430.5
- GRAVY: -0.00180723
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 73.6)
- TheSEED :
- Repressor of toxins Rot
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 72.6)and 3 moreMarR; MarR family (PF01047; HMM-score: 31.4)no clan defined DUF2949; Protein of unknown function (DUF2949) (PF11165; HMM-score: 14.2)FMN-binding (CL0336) DUF447_N; Protein of unknown function (DUF447) N-terminal domain (PF04289; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9178
- Cytoplasmic Membrane Score: 0.0073
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0747
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.041759
- TAT(Tat/SPI): 0.000345
- LIPO(Sec/SPII): 0.131707
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFSEIESEYKMSREEILILLTLWQKGFMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Stephan Fuchs, Jan Pané-Farré, Christian Kohler, Michael Hecker, Susanne Engelmann
Anaerobic gene expression in Staphylococcus aureus.
J Bacteriol: 2007, 189(11);4275-89
[PubMed:17384184] [WorldCat.org] [DOI] (P p)