From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1708
  • pan locus tag?: SAUPAN004448000
  • symbol: rot
  • pan gene symbol?: rot
  • synonym:
  • product: accessory regulator Rot

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1708
  • symbol: rot
  • product: accessory regulator Rot
  • replicon: chromosome
  • strand: -
  • coordinates: 1890756..1891256
  • length: 501
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGCATAAGTTAGCACATACAAGTTTTGGGATTGTTGGGATGTTTGTTAATACTTGTATA
    GTAGCTAAATATGTGATTATTAATTGGGAGATGTTTAGCATGAAAAAAGTAAATAACGAC
    ACTGTATTTGGAATTTTGCAATTAGAAACACTTTTGGGTGACATTAACTCAATTTTCAGC
    GAGATTGAAAGCGAATACAAAATGTCTAGAGAAGAAATTTTAATTTTACTAACTTTATGG
    CAAAAAGGTTCTATGACGCTTAAAGAAATGGACAGATTTGTTGAAGTTAAACCGTATAAG
    CGTACGAGAACGTATAATAATTTAGTTGAATTAGAATGGATTTACAAAGAGCGTCCTGTT
    GACGATGAAAGAACAGTTATTATTCATTTCAATGAAAAGTTACAACAAGAGAAAGTAGAG
    TTGTTGAATTTCATCAGTGATGCGATTGCAAGTAGAGCAACAGCAATGCAAAATAGTTTA
    AACGCAATTATTGCTGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1708
  • symbol: Rot
  • description: accessory regulator Rot
  • length: 166
  • theoretical pI: 5.7418
  • theoretical MW: 19370.5
  • GRAVY: -0.023494

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 76.3)
  • TheSEED  :
    • Repressor of toxins Rot
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 32.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.041759
    • TAT(Tat/SPI): 0.000345
    • LIPO(Sec/SPII): 0.131707
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • rot no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Hsin-Yeh Hsieh, Ching Wen Tseng, George C Stewart
Regulation of Rot expression in Staphylococcus aureus.
J Bacteriol: 2008, 190(2);546-54
[PubMed:17981965] [WorldCat.org] [DOI] (I p)
April Killikelly, Meredith A Benson, Elizabeth A Ohneck, Jared M Sampson, Jean Jakoncic, Brett Spurrier, Victor J Torres, Xiang-Peng Kong
Structure-based functional characterization of repressor of toxin (Rot), a central regulator of Staphylococcus aureus virulence.
J Bacteriol: 2015, 197(1);188-200
[PubMed:25331435] [WorldCat.org] [DOI] (I p)