From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1827 [new locus tag: SACOL_RS09365 ]
  • pan locus tag?: SAUPAN004470000
  • symbol: SACOL1827
  • pan gene symbol?: sigS
  • synonym:
  • product: RNA polymerase sigma-70 family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1827 [new locus tag: SACOL_RS09365 ]
  • symbol: SACOL1827
  • product: RNA polymerase sigma-70 family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1882333..1882803
  • length: 471
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAATTTAATGACGTATACAACAAACACCACAAAATCATACACCATCTTTTAAAAAAA
    TATAATATTAGCTATAATTATGATGAGTATTATCAACTACTCTTGATAAAAATGTGGCAA
    TTGAGTCAGATATATAAACCCTCAAGCAAGCAATCTTTATCCTCTTTTTTATTCACTCGA
    TTAAATTTTTACCTTATCGATTTATTCAGACAACAAAATCAATTAAAAGATGTCATTTTA
    TGTGAGAATAATTCACCAACATTAACTGAACAACCAACATACTTTAATGAACATGACCTT
    CGTTTACAAGATATCTTCAAGCTTTTAAATCAAAGAGAAAGACTATGGCTCAAACTATAC
    CTTGAAGGATACAAGCAATTTGAAATTGCTGAAATCATGTCATTATCGCTTTCAACGATT
    AAATTAATTAAGATGTCCGTTAAGCGTAAATGCCAACATAATTTTAATTAG
    60
    120
    180
    240
    300
    360
    420
    471

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1827 [new locus tag: SACOL_RS09365 ]
  • symbol: SACOL1827
  • description: RNA polymerase sigma-70 family protein
  • length: 156
  • theoretical pI: 9.80207
  • theoretical MW: 19136.1
  • GRAVY: -0.479487

⊟Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 61.5)
    and 11 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 28.9)
    RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 25.7)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 23.9)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 22.6)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.5)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 15.1)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 15)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 11.9)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 11.9)
  • TheSEED  :
    • RNA polymerase sigma factor SigS
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 28.9)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 24.3)
    and 6 more
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 20)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.5)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 13.2)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 12.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.1)
    no clan defined DUF3837; Domain of unknown function (DUF3837) (PF12939; HMM-score: 9.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003706
    • TAT(Tat/SPI): 0.000167
    • LIPO(Sec/SPII): 0.000947
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLLLIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTYFNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHNFN

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Lindsey N Shaw, Catharina Lindholm, Tomasz K Prajsnar, Halie K Miller, Melanie C Brown, Ewa Golonka, George C Stewart, Andrej Tarkowski, Jan Potempa
Identification and characterization of sigma, a novel component of the Staphylococcus aureus stress and virulence responses.
PLoS One: 2008, 3(12);e3844
[PubMed:19050758] [WorldCat.org] [DOI] (I p)

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1827&oldid=70283"