From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
  • pan locus tag?: SAUPAN004781000
  • symbol: SACOL1905
  • pan gene symbol?: airR
  • synonym:
  • product: LuxR family DNA-binding response regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
  • symbol: SACOL1905
  • product: LuxR family DNA-binding response regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1960362..1960985
  • length: 624
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAAGTAATATTAGTAGATGACCATTATATTGTGCGACAAGGATTGCGATTTTTA
    TTATCCACGATTGAAAACATAGAAGTTTTACAAGACTTTGCAGATGGAGAAACATTTTTA
    GAATATTTAAAAGAGCATGAGCACCCTGATATTGTGCTATTAGATTTAGTGATGCCTGGC
    ATGAATGGTATTGAAATTACGGAATATATTAAGGCACATTATCCGGATATTAAAGTTTTG
    GTATTAACAAGTTATGTTGATGATGAACATGTAATTTCAGCAATCAATAAAGGTGCTGAT
    GGTTATGAAATGAAAGACGTTGAGCCTCAGCAATTAATTGAAACTATTAGACGAGTTATG
    AACGGTGAAAAAATGATACATCCTAAGGCACAAGATGTATTCGAAACAGTTAGCCAAAAA
    CCACACTACACGAATAAGTTGTCAAAGAGAGAAATTGAAGTGTTACGTGAAATGGTTAAA
    GGTAAAACAAATAAAGAGATTGCAGAAACTTTATTTGTATCTGAAAAAACAATTAAAACA
    CATGTCAGTCATATATTTAGTAAATTACAAGTTAGCGATCGTACACAAGCAGCAATTTAT
    GCAATGGAAAATAAGTTGATTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1905 [new locus tag: SACOL_RS09810 ]
  • symbol: SACOL1905
  • description: LuxR family DNA-binding response regulator
  • length: 207
  • theoretical pI: 5.57567
  • theoretical MW: 23895.4
  • GRAVY: -0.27971

⊟Function[edit | edit source]

  • TIGRFAM:
    transcriptional regulator EpsA (TIGR03020; HMM-score: 58.4)
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 57.2)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    and 12 more
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 36.1)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.3)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 35.1)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 33.5)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 23.9)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 21.8)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21.8)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    probable regulatory domain (TIGR03879; HMM-score: 15.2)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 13.5)
  • TheSEED  :
    • Two-component transcriptional response regulator, LuxR family
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 96.5)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 83)
    and 11 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 23.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 18.7)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 17.9)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.9)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.4)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 14)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.8)
    KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 13.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.9)
    no clan defined TraC_F_IV; F pilus assembly Type-IV secretion system for plasmid transfer (PF11130; HMM-score: 12.6)
    HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002679
    • TAT(Tat/SPI): 0.000066
    • LIPO(Sec/SPII): 0.000207
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPGMNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVMNGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 56 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1905&oldid=92367"