Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2089 [new locus tag: SACOL_RS10930 ]
- pan locus tag?: SAUPAN005383000
- symbol: SACOL2089
- pan gene symbol?: ssbB
- synonym:
- product: ssDNA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2089 [new locus tag: SACOL_RS10930 ]
- symbol: SACOL2089
- product: ssDNA-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2152982..2153377
- length: 396
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238685 NCBI
- RefSeq: YP_186904 NCBI
- BioCyc: see SACOL_RS10930
- MicrobesOnline: 913565 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAG
GAGGATAGAAAAATTGCAACGTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAAT
GGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTGGCAAGTTAGCTTCTAATATA
GAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTT
ATGTCCCCTAAATCCCAAAATAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCT
CAAAATATAGATAATCATGACTTATTAGAAATTTAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2089 [new locus tag: SACOL_RS10930 ]
- symbol: SACOL2089
- description: ssDNA-binding protein
- length: 131
- theoretical pI: 5.69037
- theoretical MW: 15042
- GRAVY: -0.452672
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 71.7)
- TheSEED :
- Single-stranded DNA-binding protein
and 2 more - PFAM: OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 91)and 2 moreDUF3217; Protein of unknown function (DUF3217) (PF11506; HMM-score: 20.1)no clan defined Peptidase_Prp; Cysteine protease Prp (PF04327; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4617
- Cytoplasmic Membrane Score: 0.0026
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.535
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017717
- TAT(Tat/SPI): 0.00045
- LIPO(Sec/SPII): 0.003263
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]