From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2052 [new locus tag: SAUSA300_RS11300 ]
  • pan locus tag?: SAUPAN005383000
  • symbol: SAUSA300_2052
  • pan gene symbol?: ssbB
  • synonym:
  • product: single-stranded DNA- binding protein family

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2052 [new locus tag: SAUSA300_RS11300 ]
  • symbol: SAUSA300_2052
  • product: single-stranded DNA- binding protein family
  • replicon: chromosome
  • strand: -
  • coordinates: 2216832..2217179
  • length: 348
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAG
    GAGGATAGAAAAATTGCAACGTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAAT
    GGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTGGCAAGTTAGCTTCTAATATA
    GAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
    TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTT
    ATGTCCCCTAAATCCCAAAATAATGAAATTCTCTCAGATAGTATTTAG
    60
    120
    180
    240
    300
    348

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2052 [new locus tag: SAUSA300_RS11300 ]
  • symbol: SAUSA300_2052
  • description: single-stranded DNA- binding protein family
  • length: 115
  • theoretical pI: 8.46152
  • theoretical MW: 13193
  • GRAVY: -0.453913

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 71.9)
  • TheSEED  :
    • Single-stranded DNA-binding protein
    DNA Metabolism DNA repair DNA repair, bacterial  Single-stranded DNA-binding protein
    and 2 more
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  Single-stranded DNA-binding protein
    DNA Metabolism DNA repair DNA repair, bacterial UmuCD system  Single-stranded DNA-binding protein
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 85.6)
    and 2 more
    no clan defined DUF3217; Protein of unknown function (DUF3217) (PF11506; HMM-score: 18.1)
    OB (CL0021) tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017717
    • TAT(Tat/SPI): 0.00045
    • LIPO(Sec/SPII): 0.003263
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]