Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS11300 [old locus tag: SAUSA300_2052 ]
- pan locus tag?: SAUPAN005383000
- symbol: SAUSA300_RS11300
- pan gene symbol?: ssbB
- synonym:
- product: single-stranded DNA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS11300 [old locus tag: SAUSA300_2052 ]
- symbol: SAUSA300_RS11300
- product: single-stranded DNA-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2216832..2217179
- length: 348
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2216832..2217179) NCBI
- BioCyc: SAUSA300_RS11300 BioCyc
- MicrobesOnline: see SAUSA300_2052
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAG
GAGGATAGAAAAATTGCAACGTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAAT
GGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTGGCAAGTTAGCTTCTAATATA
GAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTT
ATGTCCCCTAAATCCCAAAATAATGAAATTCTCTCAGATAGTATTTAG60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS11300 [old locus tag: SAUSA300_2052 ]
- symbol: SAUSA300_RS11300
- description: single-stranded DNA-binding protein
- length: 115
- theoretical pI: 8.46152
- theoretical MW: 13193
- GRAVY: -0.453913
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 71.9)
- TheSEED: see SAUSA300_2052
- PFAM: OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 91.6)and 2 moreDUF3217; Protein of unknown function (DUF3217) (PF11506; HMM-score: 20.6)no clan defined Peptidase_Prp; Cysteine protease Prp (PF04327; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5125
- Cytoplasmic Membrane Score: 0.0039
- Cell wall & surface Score: 0.0013
- Extracellular Score: 0.4822
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017717
- TAT(Tat/SPI): 0.00045
- LIPO(Sec/SPII): 0.003263
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 486200553 NCBI
- RefSeq: WP_001549243 NCBI
- UniProt: see SAUSA300_2052
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]