Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2406 [new locus tag: SACOL_RS12625 ]
- pan locus tag?: SAUPAN005942000
- symbol: SACOL2406
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2406 [new locus tag: SACOL_RS12625 ]
- symbol: SACOL2406
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2467198..2467296
- length: 99
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238590 NCBI
- RefSeq: YP_187209 NCBI
- BioCyc: see SACOL_RS12625
- MicrobesOnline: 913886 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61TTGAGATCAGTAAGTGATACCAATTTATTAGGACAATACGAAAAGGCAATTTCTATTAGC
GATATGATAGAGATTGTCTTTTTAATGTATGAAGTCTAA60
99
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2406 [new locus tag: SACOL_RS12625 ]
- symbol: SACOL2406
- description: hypothetical protein
- length: 32
- theoretical pI: 3.9523
- theoretical MW: 3696.29
- GRAVY: 0.390625
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: Death (CL0041) Dredd_N; Caspase-8, N-terminal domain (PF23725; HMM-score: 15.9)no clan defined Sda; Sporulation inhibitor A (PF08970; HMM-score: 15.2)DUF5407; Family of unknown function (DUF5407) (PF17401; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5634
- Cytoplasmic Membrane Score: 0.0657
- Cell wall & surface Score: 0
- Extracellular Score: 0.3709
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.075041
- TAT(Tat/SPI): 0.004781
- LIPO(Sec/SPII): 0.037033
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRSVSDTNLLGQYEKAISISDMIEIVFLMYEV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]