Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
- pan locus tag?: SAUPAN005943000
- symbol: SACOL2407
- pan gene symbol?: dsbA
- synonym:
- product: lipoprotein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
- symbol: SACOL2407
- product: lipoprotein
- replicon: chromosome
- strand: -
- coordinates: 2467306..2467905
- length: 600
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238591 NCBI
- RefSeq: YP_187210 NCBI
- BioCyc: see SACOL_RS12630
- MicrobesOnline: 913887 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGACTAAAAAATTACTAACATTATTTATAGTGAGCATGTTAATTTTAACAGCTTGCGGT
AAAAAAGAATCAGCAACGACATCTTCGAAAAACGGCAAACCATTAGTTGTCGTATATGGC
GACTATAAATGTCCTTATTGTAAAGAATTAGATGAAAAAGTCATGCCAAAGTTGCGTAAA
AATTATATAGATAATCACAAAGTGGAATACCAATTTGTCAATTTAGCTTTCTTAGGTAAA
GACTCAATTGTTGGTTCGCGTGCGAGTCATGCAGTATTGATGTATGCACCTAAATCATTT
TTAGATTTTCAAAAGCAATTATTTGCTGCCCAGCAAGATGAAAATAAAGAATGGTTAACA
AAAGAACTATTAGATAAACATATTAAACAACTGCATTTAGATAAAGAGACGGAAAATAAA
ATTATAAAAGATTACAAGACAAAAGATAGCAAGTCTTGGAAAGCTGCAGAGAAAGATAAA
AAAATAGCGAAAGATAATCATATAAAAACGACACCAACTGCATTTATTAATGGCGAGAAA
GTTGAAGATCCATATGATTATGAAAGTTATGAGAAGTTATTAAAAGATAAAATCAAATAG60
120
180
240
300
360
420
480
540
600
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
- symbol: SACOL2407
- description: lipoprotein
- length: 199
- theoretical pI: 9.67715
- theoretical MW: 23061.6
- GRAVY: -0.680402
⊟Function[edit | edit source]
- TIGRFAM: glutaredoxin, GrxA family (TIGR02183; HMM-score: 16.9)glutaredoxin (TIGR02180; HMM-score: 15.9)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 13.6)and 2 moreglutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 11.4)extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 11)
- TheSEED :
- Protein-disulfide isomerase, related to DsbA
- PFAM: Thioredoxin (CL0172) Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 85.7)and 12 moreThioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 38.5)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 33.9)Thioredoxin_5; Thioredoxin (PF13743; HMM-score: 20)no clan defined Imm42; Immunity protein 42 (PF15593; HMM-score: 18)Thioredoxin (CL0172) Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 16.6)no clan defined VSR_TRX; Vacuolar sorting receptor thioredoxin-like domain (PF25011; HMM-score: 15.7)Thioredoxin (CL0172) Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15.5)C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.9)Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 14.5)Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.2)Zn_Beta_Ribbon (CL0167) Toprim_Crpt; C-terminal repeat of topoisomerase (PF13342; HMM-score: 13)LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.53
- Cellwall Score: 8.75
- Extracellular Score: 0.7
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9842
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.0146
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: ILTACGK
- SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
- SP(Sec/SPI): 0.001408
- TAT(Tat/SPI): 0.000083
- LIPO(Sec/SPII): 0.998331
- Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9990
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKDKIK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)