From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
  • pan locus tag?: SAUPAN005943000
  • symbol: SACOL2407
  • pan gene symbol?: dsbA
  • synonym:
  • product: lipoprotein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
  • symbol: SACOL2407
  • product: lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 2467306..2467905
  • length: 600
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGACTAAAAAATTACTAACATTATTTATAGTGAGCATGTTAATTTTAACAGCTTGCGGT
    AAAAAAGAATCAGCAACGACATCTTCGAAAAACGGCAAACCATTAGTTGTCGTATATGGC
    GACTATAAATGTCCTTATTGTAAAGAATTAGATGAAAAAGTCATGCCAAAGTTGCGTAAA
    AATTATATAGATAATCACAAAGTGGAATACCAATTTGTCAATTTAGCTTTCTTAGGTAAA
    GACTCAATTGTTGGTTCGCGTGCGAGTCATGCAGTATTGATGTATGCACCTAAATCATTT
    TTAGATTTTCAAAAGCAATTATTTGCTGCCCAGCAAGATGAAAATAAAGAATGGTTAACA
    AAAGAACTATTAGATAAACATATTAAACAACTGCATTTAGATAAAGAGACGGAAAATAAA
    ATTATAAAAGATTACAAGACAAAAGATAGCAAGTCTTGGAAAGCTGCAGAGAAAGATAAA
    AAAATAGCGAAAGATAATCATATAAAAACGACACCAACTGCATTTATTAATGGCGAGAAA
    GTTGAAGATCCATATGATTATGAAAGTTATGAGAAGTTATTAAAAGATAAAATCAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2407 [new locus tag: SACOL_RS12630 ]
  • symbol: SACOL2407
  • description: lipoprotein
  • length: 199
  • theoretical pI: 9.67715
  • theoretical MW: 23061.6
  • GRAVY: -0.680402

Function[edit | edit source]

  • TIGRFAM:
    glutaredoxin, GrxA family (TIGR02183; HMM-score: 16.9)
    glutaredoxin (TIGR02180; HMM-score: 15.9)
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 13.6)
    and 2 more
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 11.4)
    extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 11)
  • TheSEED  :
    • Protein-disulfide isomerase, related to DsbA
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 85.7)
    and 12 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 38.5)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 33.9)
    Thioredoxin_5; Thioredoxin (PF13743; HMM-score: 20)
    no clan defined Imm42; Immunity protein 42 (PF15593; HMM-score: 18)
    Thioredoxin (CL0172) Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 16.6)
    no clan defined VSR_TRX; Vacuolar sorting receptor thioredoxin-like domain (PF25011; HMM-score: 15.7)
    Thioredoxin (CL0172) Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15.5)
    C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.9)
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 14.5)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.2)
    Zn_Beta_Ribbon (CL0167) Toprim_Crpt; C-terminal repeat of topoisomerase (PF13342; HMM-score: 13)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9842
    • Cell wall & surface Score: 0.0012
    • Extracellular Score: 0.0146
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: ILTACGK
  • SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
    • SP(Sec/SPI): 0.001408
    • TAT(Tat/SPI): 0.000083
    • LIPO(Sec/SPII): 0.998331
    • Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9990
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKDKIK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]