From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2445 [new locus tag: SACOL_RS12835 ]
  • pan locus tag?: SAUPAN005992000
  • symbol: SACOL2445
  • pan gene symbol?: flp
  • synonym:
  • product: fmtA-like protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2445 [new locus tag: SACOL_RS12835 ]
  • symbol: SACOL2445
  • product: fmtA-like protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2504441..2505937
  • length: 1497
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    ATGACTACTAAAAAACTGTATTTTCTATCCATTTCTATTATCATTATAGTCGCCATTTCA
    ATTGCTATATATATAACATTAAATAGCAATACGAAGACACGGTTAACCAATGATTCGCAA
    CAACAAATAGATACAATTATCGAGCATGATTTACAAAAGGGACACATTCCTGGAGCATCA
    ATTTTAATAGTAAAAAATGGCAAAGTTTTTTTAAATAAAGGTTATGGTTATCAAGATGTT
    GATAAAAAAGTCAAAGCTTCTCCCACAACAAAGTATGAAATTGCTTCTAATACGAAAGCT
    TTCACAGGTCTTGCAATTTTAAAATTAGCTCAAGAAGGTCGATTAAACTTAAATGATGCC
    GTATCCAAACATGTGCCTCATTTTAAAATGAACTATAATGGTCAAAATGAAACTATTACG
    ATTAAGCAACTTTTGGCTCAAACAAGTGGTATACCTAGTGATATTACAAGCGAAGATTCT
    GTGACAAGCAAAAATAATCGTTTAAATGATGTAACCCGTGCAATTATGGGTGATGAATTA
    CATCATAAGCCCGGAGAAGAATTTGAATACTCAAATATGAACTATGATTTATTAGGTTTA
    ATTATCCAAAACGTTACGAAGCAATCCTATACAAAATATATTACAAATTCATGGCTCAAG
    CCTTTGCATATGACACATACATCATTCAAACAAACCAATTACAAATCAAAACATGATGCT
    ATTGGCTATGAATTACAAGGTTCGACACCTGTCGTCTCTAAACCTGAATTTAACCTTTGG
    GATACACCATCAGCATATATGATGACATCAACTGAAGATTTGGAACATTGGATAAAATTC
    CAACTTAATCCACCTGATAAATACAAATCATTAGTTCAACAATCACATAAAAATTTATCT
    TCAACAATTGGTGAACCTAATGCCAATGCATATGCTTCCGGCTGGTTTACCAATAATGAT
    GAACATTTAGTGTTTCATTCAGGAACGCTAGATAACTTTTCATCATTTATTTTACTAAAT
    CCAAAACAAAATTATGGAATTGTTGTACTTGCAAATCTAAATTCGGAATATGTACCCAAA
    TTAGTTGAGCATCTTAATACACAAATTGTAAATCACAAGCGATATTCGACGGTTGCGTCT
    ATGCTCAATCAATATAAAGATCAATTTAATATTGTTACCGTTTTGATGACAACACTTATT
    TTATTAGCATTTATATTCTCAGCTTATCGTGCTTGGCAAATGCGCCATGGTCAAATTCTT
    TTGCGTAGATCAAAACGGATTGCTGTATTGAGTTGGTTATCATTATGTATATGTATCGCT
    TTAGCGCTCATATTATATGCATTACCATATCTCATTCTCGGTAGCAATAATTGGTCTTTT
    GTACTGACTTGGCTACCAATAGAAATTAAATTAGCACTAATCACAACATTAATTGCATTA
    TTCAGTACATTAATTGTAATTCTGTTATTCCTTCATACAAAGATAACGAAGACATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1497

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2445 [new locus tag: SACOL_RS12835 ]
  • symbol: SACOL2445
  • description: fmtA-like protein
  • length: 498
  • theoretical pI: 9.65027
  • theoretical MW: 56466.8
  • GRAVY: -0.0732932

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Beta-lactamase  Beta-lactamase (EC 3.5.2.6)
  • PFAM:
    Beta-lactamase (CL0013) Beta-lactamase; Beta-lactamase (PF00144; HMM-score: 235.1)
    and 1 more
    GPCR_A (CL0192) 7tm_3; 7 transmembrane sweet-taste receptor of 3 GCPR (PF00003; HMM-score: 17.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 33 aa
    • SP(Sec/SPI): 0.488347
    • TAT(Tat/SPI): 0.001448
    • LIPO(Sec/SPII): 0.085088
    • Cleavage Site: CS pos: 33-34. TKT-RL. Pr: 0.0586
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTTKKLYFLSISIIIIVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGASILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDAVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTRAIMGDELHHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDAIGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLSSTIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPKLVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQILLRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIALFSTLIVILLFLHTKITKT

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1] [2]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL2445 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

H Komatsuzawa, G H Choi, T Fujiwara, Y Huang, K Ohta, M Sugai, H Suginaka
Identification of a fmtA-like gene that has similarity to other PBPs and beta-lactamases in Staphylococcus aureus.
FEMS Microbiol Lett: 2000, 188(1);35-9
[PubMed:10867231] [WorldCat.org] [DOI] (P p)