Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2486 [new locus tag: SACOL_RS13025 ]
- pan locus tag?: SAUPAN006046000
- symbol: SACOL2486
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2486 [new locus tag: SACOL_RS13025 ]
- symbol: SACOL2486
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2542260..2542679
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238116 NCBI
- RefSeq: YP_187282 NCBI
- BioCyc: see SACOL_RS13025
- MicrobesOnline: 913960 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAAAAAGAAAATTTTAATATTAACTAGTATTATGTTAATCATATTAATTAGTGTT
GCAGGTATCTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
AAAGAACAACAAGCGCGCATTACACTTTATCTCAAGCATAACACTAAAGAACCGAATACA
ATCAAATCTGTACATTTCACAAACTCGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
GGTTACATAAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
TATCAATTTGGTGGTGCTATGATAGAAAGTGAAAAATTAAGCGAGTTACTAAAGCCAGCC
AATCAGTTAAAATCACCAGATGATATAAAAAAAGAACTAAATAAAAAGAAGAGTCACTAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2486 [new locus tag: SACOL_RS13025 ]
- symbol: SACOL2486
- description: hypothetical protein
- length: 139
- theoretical pI: 9.9502
- theoretical MW: 15936.4
- GRAVY: -0.626619
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108221: hypothetical protein
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 128.4)and 4 moreViral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 16)Ninjurin; Ninjurin (PF04923; HMM-score: 13.3)ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 12.8)no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.6687
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.3303
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.316387
- TAT(Tat/SPI): 0.001491
- LIPO(Sec/SPII): 0.072354
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKKKILILTSIMLIILISVAGIYLKVKYDEKEKQKAIYYKEQQARITLYLKHNTKEPNTIKSVHFTNSETSPMGSAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESEKLSELLKPANQLKSPDDIKKELNKKKSH
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Signal peptide containing [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)