Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2595
- pan locus tag?: SAUPAN006254000
- symbol: SACOL2595
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2595
- symbol: SACOL2595
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2656321..2656428
- length: 108
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3237202 NCBI
- RefSeq: YP_187386 NCBI
- BioCyc:
- MicrobesOnline: 914065 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGTTACAAACATTGAAATTAGAGGTATATAAAAAATGCTTCTGCAATAGATGCAATAAA
CATGCAATACAATATGGAGGCGAAGTAAATGAAAAGTATTACGTTTGA60
108
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2595
- symbol: SACOL2595
- description: hypothetical protein
- length: 35
- theoretical pI: 8.85845
- theoretical MW: 4214.93
- GRAVY: -0.554286
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: TIM_barrel (CL0036) TIM; Triosephosphate isomerase (PF00121; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.198863
- TAT(Tat/SPI): 0.00587
- LIPO(Sec/SPII): 0.066444
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLQTLKLEVYKKCFCNRCNKHAIQYGGEVNEKYYV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)