Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2650 [new locus tag: SACOL_RS13880 ]
- pan locus tag?: SAUPAN006354000
- symbol: SACOL2650
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2650 [new locus tag: SACOL_RS13880 ]
- symbol: SACOL2650
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2709459..2709914
- length: 456
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237053 NCBI
- RefSeq: YP_187438 NCBI
- BioCyc: see SACOL_RS13880
- MicrobesOnline: 914117 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTCGACCAATAAAAACGATTATGAGCATATGTTGTTTTATTTTGCATATAAAACCTTT
ATTACTACCGCTGATGAAATTATAGAGAAGTATGGTATGAGTCGTCAGCATCATCGTTTT
TTGTTTTTTATCAATAAATTACCTGGTATTACTATTAAATCATTACTAGAAATATTAGAA
ATTTCTAAACAAGGATCACATGCAACACTTCAAAAATTAAAAGAGCAAGGTCTCATTATT
GAAAAAGTTTTAGAGACTGATCGACGTGTCAAAAAATTATATTCGACGGATAAAGGCGAT
CAACTCATTGCTGAATTGAACAAGGCGCAAGATGAATTATTGCAAAATATATATCAACAA
GTCGGTTCGGATTGGTATGATGTGATGGAAGCATTGGCTAAAGGGCGACCTGGCTTTGAT
TTTATTAAGCATTTGAAAGATGAAAAAGAAAGCTAG60
120
180
240
300
360
420
456
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2650 [new locus tag: SACOL_RS13880 ]
- symbol: SACOL2650
- description: transcriptional regulator
- length: 151
- theoretical pI: 7.09112
- theoretical MW: 17692.2
- GRAVY: -0.531126
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 29.6)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 24.7)and 1 moreDNA metabolism DNA replication, recombination, and repair S4 domain protein YaaA (TIGR02988; HMM-score: 13.4)
- TheSEED :
- Transcriptional regulator, MarR family
- PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 50.7)and 12 moreHTH_11; HTH domain (PF08279; HMM-score: 23.5)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.3)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 17.3)MarR; MarR family (PF01047; HMM-score: 17)no clan defined PhaP_Bmeg; Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg) (PF09602; HMM-score: 17)HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 16.6)F-93_WHD; F-93, winged-helix domain (PF22194; HMM-score: 14)ANL (CL0378) GH3_N_vert; Vertebrate GH3, N-terminal domain (PF25146; HMM-score: 13.6)HTH (CL0123) HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 13.5)MCM_C; MCM protein C-terminal winged helix-turn-helix domain (PF21100; HMM-score: 13.3)HTH_67; Helix-turn-helix family (PF21863; HMM-score: 13)Tbcl_zf (CL0839) Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8798
- Cytoplasmic Membrane Score: 0.1072
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0127
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00301
- TAT(Tat/SPI): 0.000505
- LIPO(Sec/SPII): 0.000686
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKSLLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELLQNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 118 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 27.03 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
