Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01410 [old locus tag: SACOL0278 ]
- pan locus tag?: SAUPAN001186000
- symbol: SACOL_RS01410
- pan gene symbol?: esxB
- synonym:
- product: virulence factor EsxB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01410 [old locus tag: SACOL0278 ]
- symbol: SACOL_RS01410
- product: virulence factor EsxB
- replicon: chromosome
- strand: +
- coordinates: 320168..320482
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGGTGGATATAAAGGTATTAAAGCAGATGGTGGCAAGGTTGATCAAGCGAAACAATTA
GCGGCAAAAACAGCTAAAGATATTGAAGCATGTCAAAAGCAAACGCAACAGCTCGCTGAG
TATATCGAAGGTAGTGATTGGGAAGGACAGTTCGCCAATAAGGTGAAAGATGTGTTACTC
ATTATGGCAAAGTTTCAAGAAGAATTAGTACAACCGATGGCTGACCATCAAAAAGCAATT
GATAACTTAAGTCAAAATCTAGCGAAATACGATACATTATCAATTAAGCAAGGGCTTGAT
AGGGTGAACCCATGA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01410 [old locus tag: SACOL0278 ]
- symbol: SACOL_RS01410
- description: virulence factor EsxB
- length: 104
- theoretical pI: 5.87793
- theoretical MW: 11510
- GRAVY: -0.625
⊟Function[edit | edit source]
- TIGRFAM: WXG100 family type VII secretion target (TIGR03930; HMM-score: 20.8)and 1 moreDNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 13.5)
- TheSEED: see SACOL0278
- PFAM: EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 50.5)and 8 moreP-loop_NTPase (CL0023) ADDB_N; ADDB, N-terminal (PF21445; HMM-score: 22.6)no clan defined DUF4298; Domain of unknown function (DUF4298) (PF14131; HMM-score: 15.8)Alpha_Helical; Alpha helical domain (PF18489; HMM-score: 13.9)Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 13.4)FlaX; FlaX (PF24151; HMM-score: 13)SlyX; SlyX (PF04102; HMM-score: 12.8)KNOX2; KNOX2 domain (PF03791; HMM-score: 12.6)DivIVA; DivIVA protein (PF05103; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 9.98
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.9993
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009569
- TAT(Tat/SPI): 0.000406
- LIPO(Sec/SPII): 0.020639
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]