Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01800 [old locus tag: SACOL0358 ]
- pan locus tag?: SAUPAN001475000
- symbol: SACOL_RS01800
- pan gene symbol?: —
- synonym:
- product: DUF1381 domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01800 [old locus tag: SACOL0358 ]
- symbol: SACOL_RS01800
- product: DUF1381 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 371565..371771
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (371565..371771) NCBI
- BioCyc: SACOL_RS01800 BioCyc
- MicrobesOnline: see SACOL0358
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGACGCAATACTTAGTCACAACATTCAAAGATTCAACAGGACTACCACATGAACATATT
ACTGTGGCTAGAGATAATCAGACGTTTACAGTTGTTGAGGCAGAGAATAAAGAAGAAGCA
AAAGAGAAGTATGAGGCACAAGTTAAAAGGGATGCAATTATTAAAGCGAGTCAGTTGTTT
GAAAATATAAGGGAGTGTGGGAAATGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01800 [old locus tag: SACOL0358 ]
- symbol: SACOL_RS01800
- description: DUF1381 domain-containing protein
- length: 68
- theoretical pI: 5.6988
- theoretical MW: 7829.74
- GRAVY: -0.752941
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL0358
- PFAM: no clan defined DUF1381; Protein of unknown function (DUF1381) (PF07129; HMM-score: 108.2)and 1 moreYhzD; YhzD-like protein (PF14120; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.944
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0543
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008112
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.002225
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTQYLVTTFKDSTGLPHEHITVARDNQTFTVVEAENKEEAKEKYEAQVKRDAIIKASQLFENIRECGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]