Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01815 [old locus tag: SACOL0361 ]
- pan locus tag?: SAUPAN001578000
- symbol: SACOL_RS01815
- pan gene symbol?: rinB
- synonym:
- product: transcriptional activator RinB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01815 [old locus tag: SACOL0361 ]
- symbol: SACOL_RS01815
- product: transcriptional activator RinB
- replicon: chromosome
- strand: +
- coordinates: 372155..372307
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (372155..372307) NCBI
- BioCyc: SACOL_RS01815 BioCyc
- MicrobesOnline: see SACOL0361
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGACTAAACAAATATTAAGACTATTATTCTTACTAGCAATGTATGAGTTAGGTAAGTAT
GTAACTGAGCAAGTGTATATTATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGAT
TACGAAAAAATCAGAGCTGAAGTTTCATGGTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01815 [old locus tag: SACOL0361 ]
- symbol: SACOL_RS01815
- description: transcriptional activator RinB
- length: 50
- theoretical pI: 4.28987
- theoretical MW: 5917.88
- GRAVY: -0.006
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL0361
- PFAM: no clan defined RinB; Transcriptional activator RinB (PF06116; HMM-score: 86.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0216
- Cytoplasmic Membrane Score: 0.911
- Cell wall & surface Score: 0
- Extracellular Score: 0.0673
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.146618
- TAT(Tat/SPI): 0.003631
- LIPO(Sec/SPII): 0.022527
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYEKIRAEVSW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]