Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1412 [new locus tag: SAUSA300_RS07705 ]
- pan locus tag?: SAUPAN001578000
- symbol: SAUSA300_1412
- pan gene symbol?: rinB
- synonym:
- product: phiSLT ORF 50-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1412 [new locus tag: SAUSA300_RS07705 ]
- symbol: SAUSA300_1412
- product: phiSLT ORF 50-like protein
- replicon: chromosome
- strand: -
- coordinates: 1578090..1578242
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3914959 NCBI
- RefSeq: YP_494109 NCBI
- BioCyc: GH3C-1407 BioCyc
- MicrobesOnline: 1292927 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATTAAACAAATACTAAGACTATTATTCTTACTAGCAATGTATGAGTTAGGTAAGTAT
GTAACTGAGCAAGTGTATATTATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGAT
TACGAAAAAATCAGAGCTGAAGTTTCATGGTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1412 [new locus tag: SAUSA300_RS07705 ]
- symbol: SAUSA300_1412
- description: phiSLT ORF 50-like protein
- length: 50
- theoretical pI: 4.28987
- theoretical MW: 5929.93
- GRAVY: 0.098
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: Transcriptional activator rinB, phage associated
- PFAM: no clan defined RinB; Transcriptional activator RinB (PF06116; HMM-score: 86.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.154053
- TAT(Tat/SPI): 0.003063
- LIPO(Sec/SPII): 0.023013
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYEKIRAEVSW
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1411 < SAUSA300_1412 < SAUSA300_1413 < SAUSA300_1414 < SAUSA300_1415 < SAUSA300_1416 < SAUSA300_1417 < SAUSA300_1418 < SAUSA300_1419
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]