Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07705 [old locus tag: SAUSA300_1412 ]
- pan locus tag?: SAUPAN001578000
- symbol: SAUSA300_RS07705
- pan gene symbol?: rinB
- synonym:
- product: transcriptional activator RinB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07705 [old locus tag: SAUSA300_1412 ]
- symbol: SAUSA300_RS07705
- product: transcriptional activator RinB
- replicon: chromosome
- strand: -
- coordinates: 1578090..1578242
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1578090..1578242) NCBI
- BioCyc: SAUSA300_RS07705 BioCyc
- MicrobesOnline: see SAUSA300_1412
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATTAAACAAATACTAAGACTATTATTCTTACTAGCAATGTATGAGTTAGGTAAGTAT
GTAACTGAGCAAGTGTATATTATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGAT
TACGAAAAAATCAGAGCTGAAGTTTCATGGTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07705 [old locus tag: SAUSA300_1412 ]
- symbol: SAUSA300_RS07705
- description: transcriptional activator RinB
- length: 50
- theoretical pI: 4.28987
- theoretical MW: 5929.93
- GRAVY: 0.098
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1412
- PFAM: no clan defined RinB; Transcriptional activator RinB (PF06116; HMM-score: 86.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0109
- Cytoplasmic Membrane Score: 0.9424
- Cell wall & surface Score: 0
- Extracellular Score: 0.0466
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.154053
- TAT(Tat/SPI): 0.003063
- LIPO(Sec/SPII): 0.023013
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446517917 NCBI
- RefSeq: WP_000595263 NCBI
- UniProt: see SAUSA300_1412
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYEKIRAEVSW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]