Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1418 [new locus tag: SAUSA300_RS07735 ]
- pan locus tag?:
- symbol: SAUSA300_1418
- pan gene symbol?: —
- synonym:
- product: phiSLT ORF 82-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1418 [new locus tag: SAUSA300_RS07735 ]
- symbol: SAUSA300_1418
- product: phiSLT ORF 82-like protein
- replicon: chromosome
- strand: -
- coordinates: 1579819..1580067
- length: 249
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913763 NCBI
- RefSeq: YP_494115 NCBI
- BioCyc: see SAUSA300_RS07735
- MicrobesOnline: 1292933 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATAACCGCGAACAAATTGAACAATCAATTATCAGTGCTAGTGCGTATAACGGCAAT
GACACAGAGGGATTACTAAAAGAGATTGAAGACGTGTATAAGAAAGCGCAAGCGTTTGAT
GAAATACTTGAAGGTTTACCTAATGCTATGCAAGATGCACTCAAAGAAGATATTGGTCTT
GATGAAGCAGTAGGGATTATGACGGGGCAAGTGGTCTATAAATATGAGGAGGATCAGGAA
AATGACTAA60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1418 [new locus tag: SAUSA300_RS07735 ]
- symbol: SAUSA300_1418
- description: phiSLT ORF 82-like protein
- length: 82
- theoretical pI: 3.69339
- theoretical MW: 9200
- GRAVY: -0.692683
⊟Function[edit | edit source]
- TIGRFAM: hercynine metabolism small protein (TIGR04374; HMM-score: 14.1)
- TheSEED :
- Phage protein
- PFAM: no clan defined DUF1024; Protein of unknown function (DUF1024) (PF06260; HMM-score: 157.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9559
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0439
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011197
- TAT(Tat/SPI): 0.00146
- LIPO(Sec/SPII): 0.000986
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNREQIEQSIISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEDQEND
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1411 < SAUSA300_1412 < SAUSA300_1413 < SAUSA300_1414 < SAUSA300_1415 < SAUSA300_1416 < SAUSA300_1417 < SAUSA300_1418 < SAUSA300_1419
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]