From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01865 [old locus tag: SACOL0371 ]
  • pan locus tag?: SAUPAN001830000
  • symbol: SACOL_RS01865
  • pan gene symbol?:
  • synonym:
  • product: phage gp6-like head-tail connector protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01865 [old locus tag: SACOL0371 ]
  • symbol: SACOL_RS01865
  • product: phage gp6-like head-tail connector protein
  • replicon: chromosome
  • strand: +
  • coordinates: 379162..379440
  • length: 279
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (379162..379440) NCBI
  • BioCyc: SACOL_RS01865 BioCyc
  • MicrobesOnline: see SACOL0371

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTTTAGAAGAAATTAAATTGTGGTTGAGAATTGACTATAATTTCGAAAATGATTTA
    ATTGAAGGTCTCATTCAATCGGCTAAGTCTGAATTACTATTAAGTGGGGTTCCAGATTAT
    GACAAAGATGACTTGGAATACCCGCTTTTTTGTACAGCGATTAAATATATCATTGCAAGA
    GATTATGAAAGTCGTGGATACTCAAATGACCAATCTAGAAGCAAGGTGTTTAATGAAAAA
    GGATTGCAAAAAATGATTTTGAAATTAAAAAAGTGGTAG
    60
    120
    180
    240
    279

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS01865 [old locus tag: SACOL0371 ]
  • symbol: SACOL_RS01865
  • description: phage gp6-like head-tail connector protein
  • length: 92
  • theoretical pI: 4.86652
  • theoretical MW: 10885.4
  • GRAVY: -0.490217

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions uncharacterized phage protein (possible DNA packaging) (TIGR01560; HMM-score: 48)
    and 2 more
    ribose 5-phosphate isomerase (TIGR02133; EC 5.3.1.6; HMM-score: 15.6)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage conserved hypothetical protein, phiE125 gp8 family (TIGR02215; HMM-score: 13.3)
  • TheSEED: see SACOL0371
  • PFAM:
    YqbG (CL0643) Phage_connect_1; Phage gp6-like head-tail connector protein (PF05135; HMM-score: 50.5)
    and 1 more
    Phage_connect_2; Phage connector protein (PF24829; HMM-score: 14.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8027
    • Cytoplasmic Membrane Score: 0.0023
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.195
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002928
    • TAT(Tat/SPI): 0.000183
    • LIPO(Sec/SPII): 0.000244
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIARDYESRGYSNDQSRSKVFNEKGLQKMILKLKKW

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]