From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01900 [old locus tag: SACOL0378 ]
  • pan locus tag?: SAUPAN001823000
  • symbol: SACOL_RS01900
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01900 [old locus tag: SACOL0378 ]
  • symbol: SACOL_RS01900
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 382251..382409
  • length: 159
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (382251..382409) NCBI
  • BioCyc: SACOL_RS01900 BioCyc
  • MicrobesOnline: see SACOL0378

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGAGCAGTATGGGTGGACATTAACTGAAGTCAGAAAACAGCCGTATGTAAAACTTTTA
    GAAATACTTAATGAAGAGAATAAAGAAGAGACTGAAGAAAAACAAAGTGAACAAAAAGTC
    ATTACAGGTACGGATTTAAGAAAACTTTTTGGAAGCTAG
    60
    120
    159

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS01900 [old locus tag: SACOL0378 ]
  • symbol: SACOL_RS01900
  • description: hypothetical protein
  • length: 52
  • theoretical pI: 4.53074
  • theoretical MW: 6187.92
  • GRAVY: -1.04231

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0378
  • PFAM:
    no clan defined YebO; YebO-like protein (PF13974; HMM-score: 13.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013327
    • TAT(Tat/SPI): 0.0008
    • LIPO(Sec/SPII): 0.003233
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEQYGWTLTEVRKQPYVKLLEILNEENKEETEEKQSEQKVITGTDLRKLFGS

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL_RS01900&oldid=97643"