Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0378 [new locus tag: SACOL_RS01900 ]
- pan locus tag?: SAUPAN001823000
- symbol: SACOL0378
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0378 [new locus tag: SACOL_RS01900 ]
- symbol: SACOL0378
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 382251..382409
- length: 159
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236791 NCBI
- RefSeq: YP_185270 NCBI
- BioCyc: see SACOL_RS01900
- MicrobesOnline: 911849 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGAGCAGTATGGGTGGACATTAACTGAAGTCAGAAAACAGCCGTATGTAAAACTTTTA
GAAATACTTAATGAAGAGAATAAAGAAGAGACTGAAGAAAAACAAAGTGAACAAAAAGTC
ATTACAGGTACGGATTTAAGAAAACTTTTTGGAAGCTAG60
120
159
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0378 [new locus tag: SACOL_RS01900 ]
- symbol: SACOL0378
- description: hypothetical protein
- length: 52
- theoretical pI: 4.53074
- theoretical MW: 6187.92
- GRAVY: -1.04231
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8372
- Cytoplasmic Membrane Score: 0.1377
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0247
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013327
- TAT(Tat/SPI): 0.0008
- LIPO(Sec/SPII): 0.003233
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQYGWTLTEVRKQPYVKLLEILNEENKEETEEKQSEQKVITGTDLRKLFGS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0376 > SACOL0377 > SACOL0378 > SACOL0379 > SACOL0380 > SACOL0381 > SACOL0382 > SACOL0383 > SACOL0384 > SACOL0385 > SACOL0386
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]