From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
  • pan locus tag?: SAUPAN001824000
  • symbol: SACOL0377
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
  • symbol: SACOL0377
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 381859..382209
  • length: 351
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAATTTGAAATTAAAGATCGTAAAACAGGAAAAACAGAGAGCTATACAAAAGAA
    GATGTAACAATGGGCGAAGCAGAAAAATGCTATGAGTATTTAGAATTAGTAAATCAAGAG
    AATAAAAAAGAAGCACCTAACGCAACAAAAATGAGACAAAAAGAGCGACAGTTATTAGTA
    GATTTATTTAAAGATGAAGGATTGACTGAAGAAGATGTTCTGAACAAGATGAGTACTAAA
    ACTTATACAAAAGCCTTACAAGATATATTTCGAGAAATCAATGGTGAAGATGAAGAAGAT
    TCAGAAACTGAACCAGAAGAGATGGGAAAGACAGAAGAACAATCTCAATAA
    60
    120
    180
    240
    300
    351

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
  • symbol: SACOL0377
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 4.26091
  • theoretical MW: 13627
  • GRAVY: -1.31034

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Phage baseplate assembly protein
  • PFAM:

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006832
    • TAT(Tat/SPI): 0.000591
    • LIPO(Sec/SPII): 0.002342
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLVDLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]