Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
- pan locus tag?: SAUPAN001824000
- symbol: SACOL0377
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
- symbol: SACOL0377
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 381859..382209
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236790 NCBI
- RefSeq: YP_185269 NCBI
- BioCyc: see SACOL_RS01895
- MicrobesOnline: 911848 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTAAATTTGAAATTAAAGATCGTAAAACAGGAAAAACAGAGAGCTATACAAAAGAA
GATGTAACAATGGGCGAAGCAGAAAAATGCTATGAGTATTTAGAATTAGTAAATCAAGAG
AATAAAAAAGAAGCACCTAACGCAACAAAAATGAGACAAAAAGAGCGACAGTTATTAGTA
GATTTATTTAAAGATGAAGGATTGACTGAAGAAGATGTTCTGAACAAGATGAGTACTAAA
ACTTATACAAAAGCCTTACAAGATATATTTCGAGAAATCAATGGTGAAGATGAAGAAGAT
TCAGAAACTGAACCAGAAGAGATGGGAAAGACAGAAGAACAATCTCAATAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0377 [new locus tag: SACOL_RS01895 ]
- symbol: SACOL0377
- description: hypothetical protein
- length: 116
- theoretical pI: 4.26091
- theoretical MW: 13627
- GRAVY: -1.31034
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage baseplate assembly protein
- PFAM: Phage_TACs (CL0567) Phage_TAC_19; Phage tail chaperone protein (PF23857; HMM-score: 57.7)and 3 moreno clan defined NNH2; NACHT N-terminal Helical domain 2 (PF22734; HMM-score: 16.1)C2H2-zf (CL0361) zf-CRD; Cysteine rich domain with multizinc binding regions (PF17979; HMM-score: 13.6)no clan defined VIT1; VIT family (PF01988; HMM-score: 9.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9913
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0073
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006832
- TAT(Tat/SPI): 0.000591
- LIPO(Sec/SPII): 0.002342
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLVDLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0376 > SACOL0377 > SACOL0378 > SACOL0379 > SACOL0380 > SACOL0381 > SACOL0382 > SACOL0383 > SACOL0384 > SACOL0385 > SACOL0386
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p)