Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
- pan locus tag?: SAUPAN001814000
- symbol: SACOL0385
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
- symbol: SACOL0385
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 394721..395110
- length: 390
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236643 NCBI
- RefSeq: YP_185277 NCBI
- BioCyc: see SACOL_RS01935
- MicrobesOnline: 911856 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCAAATATTAGTTAACAAGCGTAATGAGATAATTTCATACGCTATCATTGGCGGCTTT
GAAGAAGGTATTGATATTGAAAATTTACCAGAAAATTTCTCTCAAGTTTTTAGACCTAAA
GCCTTTAAATATTCAAATGGGGAAATAGTTTTTAACGAAGATTATTCAGAAGAAAAAGAT
GACTTGCATCAACAGATTGACAGTGAAGAACAAAACACAGTCGCTTCTGATGACATCTTA
CGAAAAATGGTTGCTAGTATGCAGAAACAAGTTGTTCAAAGTACAAAGTTATCGATGCAA
GTTAATAAGCAAAATGCACTAATGGCAAAACAACTTGTGACACTTAATAAAAAATTAGAA
GAGGTTAAAGGAGAGACTGAAAATGCCTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
- symbol: SACOL0385
- description: hypothetical protein
- length: 129
- theoretical pI: 4.47777
- theoretical MW: 14756.5
- GRAVY: -0.614729
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage phi 11 orf46 protein homolog
- PFAM: no clan defined DUF2977; Protein of unknown function (DUF2977) (PF11192; HMM-score: 100.4)and 3 moreCCDC93_CC; CCDC93 coiled-coil domain (PF09762; HMM-score: 15.8)DUF2192; Uncharacterized protein conserved in archaea (DUF2192) (PF09958; HMM-score: 14.3)DUF7491; Coiled-coil region of unknown function (DUF7491) (PF24319; HMM-score: 9.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7988
- Cytoplasmic Membrane Score: 0.0184
- Cell wall & surface Score: 0.0824
- Extracellular Score: 0.1004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004285
- TAT(Tat/SPI): 0.000221
- LIPO(Sec/SPII): 0.000897
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQILVNKRNEIISYAIIGGFEEGIDIENLPENFSQVFRPKAFKYSNGEIVFNEDYSEEKDDLHQQIDSEEQNTVASDDILRKMVASMQKQVVQSTKLSMQVNKQNALMAKQLVTLNKKLEEVKGETENA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0376 > SACOL0377 > SACOL0378 > SACOL0379 > SACOL0380 > SACOL0381 > SACOL0382 > SACOL0383 > SACOL0384 > SACOL0385 > SACOL0386
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)