From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
  • pan locus tag?: SAUPAN001814000
  • symbol: SACOL0385
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
  • symbol: SACOL0385
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 394721..395110
  • length: 390
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCAAATATTAGTTAACAAGCGTAATGAGATAATTTCATACGCTATCATTGGCGGCTTT
    GAAGAAGGTATTGATATTGAAAATTTACCAGAAAATTTCTCTCAAGTTTTTAGACCTAAA
    GCCTTTAAATATTCAAATGGGGAAATAGTTTTTAACGAAGATTATTCAGAAGAAAAAGAT
    GACTTGCATCAACAGATTGACAGTGAAGAACAAAACACAGTCGCTTCTGATGACATCTTA
    CGAAAAATGGTTGCTAGTATGCAGAAACAAGTTGTTCAAAGTACAAAGTTATCGATGCAA
    GTTAATAAGCAAAATGCACTAATGGCAAAACAACTTGTGACACTTAATAAAAAATTAGAA
    GAGGTTAAAGGAGAGACTGAAAATGCCTAA
    60
    120
    180
    240
    300
    360
    390


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0385 [new locus tag: SACOL_RS01935 ]
  • symbol: SACOL0385
  • description: hypothetical protein
  • length: 129
  • theoretical pI: 4.47777
  • theoretical MW: 14756.5
  • GRAVY: -0.614729

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Phage phi 11 orf46 protein homolog
  • PFAM:
    no clan defined DUF2977; Protein of unknown function (DUF2977) (PF11192; HMM-score: 100.4)
    and 3 more
    CCDC93_CC; CCDC93 coiled-coil domain (PF09762; HMM-score: 15.8)
    DUF2192; Uncharacterized protein conserved in archaea (DUF2192) (PF09958; HMM-score: 14.3)
    DUF7491; Coiled-coil region of unknown function (DUF7491) (PF24319; HMM-score: 9.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7988
    • Cytoplasmic Membrane Score: 0.0184
    • Cell wall & surface Score: 0.0824
    • Extracellular Score: 0.1004
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004285
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.000897
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MQILVNKRNEIISYAIIGGFEEGIDIENLPENFSQVFRPKAFKYSNGEIVFNEDYSEEKDDLHQQIDSEEQNTVASDDILRKMVASMQKQVVQSTKLSMQVNKQNALMAKQLVTLNKKLEEVKGETENA

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]