⊟Summary[edit | edit source]
- pan ID?: SAUPAN001824000
- symbol?: —
- synonym:
- description?: phiSLT ORF116b-like protein
- phiSLT ORF116b-like protein
- phage protein
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 2271344..2271694
- synteny block?: BlockID0012000
- occurrence?: in 47% of 34 strains
⊟Additional information[edit | edit source]
tacS (gpG) : serogroup A prophage tail assembly chaperone small subunit [1]
Staphylococcal prophages require tail assembly chaperone proteins (TACs) to coat the tape measure protein and prevent asynchronized and unstructured major tail tube protein binding. They will then nucleate major tail tube protein polymerization and be displaced by major tail tube protein subunits in orderly tail tube assembly. This small subunit is generated approximately 96.5% of the time - however, at a 3.5% frequency, a programmed translational frameshift at the G GGA AAG slippery coding sequence results in a longer "TacL" product represented by SAUPAN001823000. The balance of these two chaperone lengths allows TACs to properly coat the tape measure protein and prevent binding of both MtpS and MtpL subunits.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| COL | |
| NCTC8325 | |
| USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
COL MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLV
NCTC8325 MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLV
USA300_FPR3757 MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLV
************************************************************
COL DLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ
NCTC8325 DLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ
USA300_FPR3757 DLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ
********************************************************
⊟Literature[edit | edit source]
- ↑ Jun Xu, Roger W Hendrix, Robert L Duda
Conserved translational frameshift in dsDNA bacteriophage tail assembly genes.
Mol Cell: 2004, 16(1);11-21
[PubMed:15469818] [WorldCat.org] [DOI] (P p)Lisa G Pell, Nichole Cumby, Teresa E Clark, Ashleigh Tuite, Kevin P Battaile, Aled M Edwards, Nickolay Y Chirgadze, Alan R Davidson, Karen L Maxwell
A conserved spiral structure for highly diverged phage tail assembly chaperones.
J Mol Biol: 2013, 425(14);2436-49
[PubMed:23542344] [WorldCat.org] [DOI] (I p)