Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1395 [new locus tag: SAUSA300_RS07610 ]
- pan locus tag?: SAUPAN001824000
- symbol: SAUSA300_1395
- pan gene symbol?: —
- synonym:
- product: phiSLT ORF116b-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1395 [new locus tag: SAUSA300_RS07610 ]
- symbol: SAUSA300_1395
- product: phiSLT ORF116b-like protein
- replicon: chromosome
- strand: -
- coordinates: 1563783..1564133
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913765 NCBI
- RefSeq: YP_494092 NCBI
- BioCyc: see SAUSA300_RS07610
- MicrobesOnline: 1292910 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTAAATTTGAAATTAAAGATCGTAAAACAGGAAAAACAGAGAGCTATACAAAAGAA
GATGTAACAATGGGCGAAGCAGAAAAATGCTATGAGTATTTAGAATTAGTAAATCAAGAG
AATAAAAAAGAAGCACCTAACGCAACAAAAATGAGACAAAAAGAGCGACAGTTATTAGTA
GATTTATTTAAAGATGAAGGATTGACTGAAGAAGATGTTCTGAACAAGATGAGTACTAAA
ACTTATACAAAAGCCTTACAAGATATATTTCGAGAAATCAATGGTGAAGATGAAGAAGAT
TCAGAAACTGAACCAGAAGAGATGGGAAAGACAGAAGAACAATCTCAATAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1395 [new locus tag: SAUSA300_RS07610 ]
- symbol: SAUSA300_1395
- description: phiSLT ORF116b-like protein
- length: 116
- theoretical pI: 4.26091
- theoretical MW: 13627
- GRAVY: -1.31034
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage baseplate assembly protein
- PFAM: Phage_TACs (CL0567) Phage_TAC_19; Phage tail chaperone protein (PF23857; HMM-score: 57.7)and 3 moreno clan defined NNH2; NACHT N-terminal Helical domain 2 (PF22734; HMM-score: 16.1)C2H2-zf (CL0361) zf-CRD; Cysteine rich domain with multizinc binding regions (PF17979; HMM-score: 13.6)no clan defined VIT1; VIT family (PF01988; HMM-score: 9.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9913
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0073
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006832
- TAT(Tat/SPI): 0.000591
- LIPO(Sec/SPII): 0.002342
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKFEIKDRKTGKTESYTKEDVTMGEAEKCYEYLELVNQENKKEAPNATKMRQKERQLLVDLFKDEGLTEEDVLNKMSTKTYTKALQDIFREINGEDEEDSETEPEEMGKTEEQSQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.