Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS09530 [old locus tag: SACOL1857 ]
- pan locus tag?: SAUPAN004549000
- symbol: SACOL_RS09530
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS09530 [old locus tag: SACOL1857 ]
- symbol: SACOL_RS09530
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1907606..1907965
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (1907606..1907965) NCBI
- BioCyc: SACOL_RS09530 BioCyc
- MicrobesOnline: see SACOL1857
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTGTAATTATAATTTTAATATTGATTCTAGGCGGAATCTTTTTGAAGATGAAATAT
GACGAAAAGAAATATTATGATGAACAAAAAGAAAGAATAACGATTTATATGAAGTACAAT
GTGAAAGGTTATAAAAATATAAGCTTCGCTAATTTTAAAGAAAACCCAATGGATGGTTAT
TCTATTAGTGGTTATATAAATAATGATAAAAAGTTATCATTTACAGCTGGTATAAGATCT
GTTGATGATTTTCAATTTGATACCGATATTTCTTATACAGATGAATTGGGTAGAAAATTT
AATAAAAATCCTAAGTCAGTTTCTGAAATAAAAAAAGAGCAAAATACGTCCAATAAATAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS09530 [old locus tag: SACOL1857 ]
- symbol: SACOL_RS09530
- description: hypothetical protein
- length: 119
- theoretical pI: 9.5862
- theoretical MW: 13951.9
- GRAVY: -0.603361
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL1857
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 124.7)and 4 moreDUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 20.6)DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 13.2)2-oxogl_dehyd_N; 2-oxoglutarate dehydrogenase N-terminus (PF16078; HMM-score: 12.6)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 10)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.5395
- Cell wall & surface Score: 0.002
- Extracellular Score: 0.4581
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.088222
- TAT(Tat/SPI): 0.002009
- LIPO(Sec/SPII): 0.024678
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIVIIILILILGGIFLKMKYDEKKYYDEQKERITIYMKYNVKGYKNISFANFKENPMDGYSISGYINNDKKLSFTAGIRSVDDFQFDTDISYTDELGRKFNKNPKSVSEIKKEQNTSNK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: see SACOL1857
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]