Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS11730 [old locus tag: SACOL2229 ]
- pan locus tag?: SAUPAN005692000
- symbol: SACOL_RS11730
- pan gene symbol?: rplN
- synonym:
- product: 50S ribosomal protein L14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS11730 [old locus tag: SACOL2229 ]
- symbol: SACOL_RS11730
- product: 50S ribosomal protein L14
- replicon: chromosome
- strand: -
- coordinates: 2301970..2302338
- length: 369
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATCCAACAAGAAACACGCTTGAAAGTAGCAGACAACTCTGGTGCTCGTGAAGTTCTT
ACAATCAAAGTATTAGGTGGATCTGGTCGTAAAACAGCAAACATCGGCGATGTTATCGTA
TGTACTGTTAAAAATGCAACACCAGGTGGCGTTGTTAAAAAAGGTGACGTTGTCAAAGCT
GTAATCGTACGTACTAAGTCAGGTGTTCGTCGTAATGACGGTTCATACATCAAATTTGAT
GAAAATGCATGTGTTATCATCCGTGATGACAAAGGCCCACGTGGTACTCGTATCTTCGGA
CCTGTTGCTCGTGAATTACGTGAAGGTAACTTCATGAAAATCGTATCATTAGCACCAGAA
GTACTTTAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SACOL_RS11730 [old locus tag: SACOL2229 ]
- symbol: SACOL_RS11730
- description: 50S ribosomal protein L14
- length: 122
- theoretical pI: 10.7254
- theoretical MW: 13135.2
- GRAVY: -0.141803
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL14 (TIGR01067; HMM-score: 192.3)and 1 more50S ribosomal protein uL14 (TIGR03673; HMM-score: 96.6)
- TheSEED:
- PFAM: no clan defined Ribosomal_L14; Ribosomal protein L14p/L23e (PF00238; HMM-score: 180.3)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SACOL_RS11135 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS00120 DNA-binding response regulator [1] (data from MRSA252) SACOL_RS00880 indolepyruvate decarboxylase [1] (data from MRSA252) SACOL_RS02780 ribose-phosphate pyrophosphokinase [1] (data from MRSA252) SACOL_RS02930 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03040 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL_RS03075 elongation factor G [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS03235 hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS04075 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SACOL_RS04330 enolase [1] (data from MRSA252) SACOL_RS04840 NADH dehydrogenase [1] (data from MRSA252) SACOL_RS04980 hypothetical protein [1] (data from MRSA252) SACOL_RS05645 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SACOL_RS06140 cell division protein FtsZ [1] (data from MRSA252) SACOL_RS06225 carbamoyl-phosphate synthase large chain [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS06575 translation initiation factor IF-2 [1] (data from MRSA252) SACOL_RS07525 serine/threonine dehydratase [1] (data from MRSA252) SACOL_RS08345 molecular chaperone DnaK [1] (data from MRSA252) SACOL_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SACOL_RS08930 pyruvate kinase [1] (data from MRSA252) SACOL_RS08970 universal stress protein [1] (data from MRSA252) SACOL_RS08995 universal stress protein UspA [1] (data from MRSA252) SACOL_RS09000 acetate kinase [1] (data from MRSA252) SACOL_RS09425 S-adenosylmethionine synthase [1] (data from MRSA252) SACOL_RS11435 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11750 30S ribosomal protein S3 [1] (data from MRSA252) SACOL_RS11755 50S ribosomal protein L22 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS13365 pyruvate oxidase [1] (data from MRSA252) SACOL_RS13725 malate:quinone oxidoreductase [1] (data from MRSA252) SACOL_RS13900 carbamate kinase 2 [1] (data from MRSA252) SACOL_RS13915 arginine deiminase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.091516
- TAT(Tat/SPI): 0.009224
- LIPO(Sec/SPII): 0.006493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPEVL
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]