Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS11785 [old locus tag: SACOL2240 ]
- pan locus tag?: SAUPAN005703000
- symbol: SACOL_RS11785
- pan gene symbol?: rpsJ
- synonym:
- product: 30S ribosomal protein S10
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS11785 [old locus tag: SACOL2240 ]
- symbol: SACOL_RS11785
- product: 30S ribosomal protein S10
- replicon: chromosome
- strand: -
- coordinates: 2307178..2307486
- length: 309
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAAAACAAAAAATCAGAATCAGATTAAAAGCTTATGATCACCGCGTAATTGATCAA
TCAGCAGAGAAGATTGTAGAAACAGCGAAACGTTCTGGTGCAGATGTTTCTGGACCAATT
CCGTTACCAACTGAGAAATCAGTTTACACAATCATCCGTGCCGTGCATATGTATAAAGAT
TCACGTGAACAATTCGAACAACGTACACACAAACGTTTAATCGATATTGTAAACCCAACA
CCAAAAACAGTTGACGCTTTAATGGGCTTAAACTTACCATCTGGTGTAGACATCGAAATC
AAATTATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS11785 [old locus tag: SACOL2240 ]
- symbol: SACOL_RS11785
- description: 30S ribosomal protein S10
- length: 102
- theoretical pI: 10.2538
- theoretical MW: 11579.4
- GRAVY: -0.435294
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01049; HMM-score: 152.4)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS10 (TIGR01046; HMM-score: 64.4)
- TheSEED:
- PFAM: no clan defined Ribosomal_S10; Ribosomal protein S10p/S20e (PF00338; HMM-score: 121.1)and 2 moreDUF384; Domain of unknown function (DUF384) (PF04064; HMM-score: 15.6)Phi-29_GP3; Phi-29 DNA terminal protein GP3 (PF05435; HMM-score: 11.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SACOL_RS11135 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS00050 DNA gyrase subunit A [1] (data from MRSA252) SACOL_RS01040 formate acetyltransferase [1] (data from MRSA252) SACOL_RS01135 L-lactate dehydrogenase [1] (data from MRSA252) SACOL_RS03025 50S ribosomal protein L11 [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03040 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL_RS03065 30S ribosomal protein S12 [1] (data from MRSA252) SACOL_RS03075 elongation factor G [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS03105 UDP-glucose 4-epimerase [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS04840 NADH dehydrogenase [1] (data from MRSA252) SACOL_RS05630 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SACOL_RS05645 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS06505 30S ribosomal protein S2 [1] (data from MRSA252) SACOL_RS06605 ribonuclease J 2 [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS08115 glycine dehydrogenase [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) SACOL_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS08930 pyruvate kinase [1] (data from MRSA252) SACOL_RS08995 universal stress protein UspA [1] (data from MRSA252) SACOL_RS10530 molecular chaperone GroEL [1] (data from MRSA252) SACOL_RS10840 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SACOL_RS11010 uracil phosphoribosyltransferase [1] (data from MRSA252) SACOL_RS11070 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS13365 pyruvate oxidase [1] (data from MRSA252) SACOL_RS13725 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004715
- TAT(Tat/SPI): 0.00042
- LIPO(Sec/SPII): 0.001281
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHMYKDSREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]