From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • pan locus tag?: SAUPAN003934000
  • symbol: SACOL_RS07705
  • pan gene symbol?: hup
  • synonym:
  • product: DNA-binding protein HU

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • symbol: SACOL_RS07705
  • product: DNA-binding protein HU
  • replicon: chromosome
  • strand: -
  • coordinates: 1552269..1552541
  • length: 273
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (1552269..1552541) NCBI
  • BioCyc: SACOL_RS07705 BioCyc
  • MicrobesOnline: see SACOL1513

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAACAAAACAGATTTAATCAATGCAGTTGCAGAGCAAGCTGATTTAACTAAAAAAGAA
    GCTGGTTCAGCAGTAGATGCTGTATTCGAATCAATCCAAAACTCACTTGCTAAAGGTGAA
    AAAGTACAATTAATTGGTTTCGGTAACTTTGAGGTACGTGAACGTGCTGCACGTAAAGGT
    CGTAACCCTCAAACTGGTAAAGAAATTGATATCCCAGCAAGTAAAGTTCCAGCATTCAAA
    GCTGGTAAAGCATTAAAAGATGCTGTAAAATAA
    60
    120
    180
    240
    273

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • symbol: SACOL_RS07705
  • description: DNA-binding protein HU
  • length: 90
  • theoretical pI: 10.3214
  • theoretical MW: 9625.94
  • GRAVY: -0.466667

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair integration host factor, beta subunit (TIGR00988; HMM-score: 85.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair integration host factor, alpha subunit (TIGR00987; HMM-score: 80.7)
    and 1 more
    Genetic information processing DNA metabolism Chromosome-associated proteins putative DNA-binding protein (TIGR01201; HMM-score: 22.4)
  • TheSEED: see SACOL1513
  • PFAM:
    IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 125.8)
    and 2 more
    no clan defined DUF4496; Domain of unknown function (DUF4496) (PF14908; HMM-score: 17.2)
    DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 16.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006571
    • TAT(Tat/SPI): 0.001468
    • LIPO(Sec/SPII): 0.001013
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL_RS07705&oldid=92747"