From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01315
  • pan locus tag?: SAUPAN003692000
  • symbol: SAOUHSC_01315
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1259029..1259217
  • length: 189
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
    GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
    TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
    AAAAATTAG
    60
    120
    180
    189


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3273
  • theoretical MW: 6956.53
  • GRAVY: 1.55323

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids MFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids bile acid transporter (TIGR00841; HMM-score: 11.5)
    and 4 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
    cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
  • TheSEED  :
    • FIG01108130: hypothetical protein
  • PFAM:
    no clan defined DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 18.3)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 15.2)
    no clan defined DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.8)
    and 18 more
    DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 13.9)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 13)
    no clan defined RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.9)
    DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 12.5)
    DUF1576; Protein of unknown function (DUF1576) (PF07613; HMM-score: 11.9)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11)
    DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.9)
    MFS (CL0015) Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 10.3)
    no clan defined Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.3)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 10.1)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.2)
    DUF6418; Family of unknown function (DUF6418) (PF19982; HMM-score: 9.2)
    TM_ErbB1; Epidermal growth factor receptor transmembrane-juxtamembrane segment (PF21314; HMM-score: 9.1)
    Holin-II (CL0563) Phage_holin_2_1; Bacteriophage P21 holin S (PF04971; HMM-score: 8.8)
    no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.5)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 8.1)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.4)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.8898
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.1099
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001472
    • TAT(Tat/SPI): 0.000247
    • LIPO(Sec/SPII): 0.052589
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]