From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1221 [new locus tag: SAUSA300_RS06620 ]
  • pan locus tag?: SAUPAN003692000
  • symbol: SAUSA300_1221
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1221 [new locus tag: SAUSA300_RS06620 ]
  • symbol: SAUSA300_1221
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1339000..1339188
  • length: 189
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
    GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
    TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
    AAAAATTAG
    60
    120
    180
    189


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1221 [new locus tag: SAUSA300_RS06620 ]
  • symbol: SAUSA300_1221
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3273
  • theoretical MW: 6956.53
  • GRAVY: 1.55323

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids MFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids bile acid transporter (TIGR00841; HMM-score: 11.5)
    and 4 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
    cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
  • TheSEED  :
    • FIG01108130: hypothetical protein
  • PFAM:
    no clan defined DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 18.3)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 15.2)
    no clan defined DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.8)
    and 18 more
    DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 13.9)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 13)
    no clan defined RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.9)
    DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 12.5)
    DUF1576; Protein of unknown function (DUF1576) (PF07613; HMM-score: 11.9)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11)
    DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.9)
    MFS (CL0015) Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 10.3)
    no clan defined Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.3)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 10.1)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.2)
    DUF6418; Family of unknown function (DUF6418) (PF19982; HMM-score: 9.2)
    TM_ErbB1; Epidermal growth factor receptor transmembrane-juxtamembrane segment (PF21314; HMM-score: 9.1)
    Holin-II (CL0563) Phage_holin_2_1; Bacteriophage P21 holin S (PF04971; HMM-score: 8.8)
    no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.5)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 8.1)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.4)
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.8898
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.1099
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001472
    • TAT(Tat/SPI): 0.000247
    • LIPO(Sec/SPII): 0.052589
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]