Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001306 [new locus tag: EGJ38_RS06520 ]
- pan locus tag?: SAUPAN003692000
- symbol: EGJ38_001306
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001306
- product: LapA family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001306 [new locus tag: EGJ38_RS06520 ]
- symbol: EGJ38_001306
- product: LapA family protein
- replicon: chromosome
- strand: -
- coordinates: 1314833..1315021
- length: 189
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423270 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
AAAAATTAG60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001306 [new locus tag: EGJ38_RS06520 ]
- symbol: EGJ38_001306
- description: LapA family protein
- length: 62
- theoretical pI: 10.3273
- theoretical MW: 6956.53
- GRAVY: 1.55323
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids MFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids bile acid transporter (TIGR00841; HMM-score: 11.5)and 4 morecxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 7.5)chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
- TheSEED: data available for N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 18.3)BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 15.2)no clan defined DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.8)and 18 moreDUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 13.9)Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 13)no clan defined RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.9)DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 12.5)DUF1576; Protein of unknown function (DUF1576) (PF07613; HMM-score: 11.9)DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11)DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.9)MFS (CL0015) Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 10.3)no clan defined Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.3)Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 10.1)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.2)DUF6418; Family of unknown function (DUF6418) (PF19982; HMM-score: 9.2)TM_ErbB1; Epidermal growth factor receptor transmembrane-juxtamembrane segment (PF21314; HMM-score: 9.1)Holin-II (CL0563) Phage_holin_2_1; Bacteriophage P21 holin S (PF04971; HMM-score: 8.8)no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.5)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 8.1)LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.4)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.8898
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.1099
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001472
- TAT(Tat/SPI): 0.000247
- LIPO(Sec/SPII): 0.052589
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423270 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]