Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01588
- pan locus tag?: SAUPAN004027000
- symbol: SAOUHSC_01588
- pan gene symbol?: scpB
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01588
- symbol: SAOUHSC_01588
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1515054..1515596
- length: 543
- essential: no [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920004 NCBI
- RefSeq: YP_500103 NCBI
- BioCyc: G1I0R-1476 BioCyc
- MicrobesOnline: 1290017 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541TTGGATAATCATGGTATATTAGAGTCGCTTTTATTTACAGCTGGCGATGAAGGTTTAGAT
GAAAAACAACTATTAGAAATATTAGATATGTCGAAAGACCAACTCGTTGAATTAATTGAA
AATTATTCATCACATGGATTAATGATACAACGATTTGGAATGACGTATGTTTTAACGACT
AAAAAAGAAGCGGCAACGTATATTGAACAATTAATTGAACAAAAGTCACAAATGAAATTA
TCACAAGCAGCAATGGAAGTACTATCAATTATTGCTTATAACCAGCCATTATCAAGAAGT
GATATTGAATTAATTCGTAGTATCAATTCAGATGGTGCAGTTAAGACATTGATTGCCAAA
GGACTAGTTGAGGCTAAAGTGGTTAATGAACAGCGTAGCCAACAGTTAATTACTACTGAT
TTATTTTTAAATGTATTTGGTATTTCCAATATAGAAGATTTGCCGACAACTGAAGAAGAC
GATGAAGAAATGGATGCTTTTTTCAGTAATCTAGTCAATCAAAAAGGAGAAAATAATGAC
TAA60
120
180
240
300
360
420
480
540
543
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01588
- symbol: SAOUHSC_01588
- description: hypothetical protein
- length: 180
- theoretical pI: 4.03334
- theoretical MW: 20235.7
- GRAVY: -0.251667
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division segregation and condensation protein B (TIGR00281; HMM-score: 122.4)DNA metabolism Chromosome-associated proteins segregation and condensation protein B (TIGR00281; HMM-score: 122.4)
- TheSEED :
- Segregation and condensation protein B
- PFAM: HTH (CL0123) SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 144.7)and 3 moreMarR_2; MarR family (PF12802; HMM-score: 16.5)no clan defined NYD-SP12_N; Spermatogenesis-associated, N-terminal (PF15015; HMM-score: 14.6)Sigma54_AID; Sigma-54 factor, Activator interacting domain (AID) (PF00309; HMM-score: 7.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9859
- Cytoplasmic Membrane Score: 0.0088
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0049
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003773
- TAT(Tat/SPI): 0.000246
- LIPO(Sec/SPII): 0.000358
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_01585 < SAOUHSC_01586 < SAOUHSC_01587 < SAOUHSC_01588 < SAOUHSC_01589predicted SigA promoter [4] : SAOUHSC_01585 < SAOUHSC_01586 < S638 < SAOUHSC_01587 < SAOUHSC_01588 < SAOUHSC_01589
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
