From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_03000
  • pan locus tag?: SAUPAN006409000
  • symbol: SAOUHSC_03000
  • pan gene symbol?: cap1A
  • synonym:
  • product: capsular polysaccharide biosynthesis protein CapA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_03000
  • symbol: SAOUHSC_03000
  • product: capsular polysaccharide biosynthesis protein CapA
  • replicon: chromosome
  • strand: -
  • coordinates: 2772939..2773601
  • length: 663
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAGAAAAGTTTGATTTAGTAAAACTATTAAATATTCTAAAGAAGAATATTAAATTA
    TTGCTTATTTTACCGGCAATATGTCTTGTAGTAAGTGCGGCATTAACCTTTTTTGTTATG
    CCTGACAAATATACTGCTTCTACTCAAATATTAGTGAACATGAAAAAGTCCTCAAGTGAT
    TTAGCTTTCCAAAATGTTCAAAGTAGTTTGCAGTCTGTTAATACATATACGGAAATTATC
    AAAAGTCCTAGAATTCTAGATAAAGTATCTAGAGAATTTGATGGTCAGTATTCAACAGCT
    GAGTTGAATTCATTTTTAAAAGTAACCAATCAAACAAACTCTCAAATTATTACTGTATCA
    GTTACCACTGGGAATAAATCTGAATCTGACAAAATTGTTAATAAAATATCTAAAGTTTTT
    GCTCATGACATGCCTAAAATTATGAGTGTTGATAATGTTACGATACTTTCCTCAGCACAT
    GATAATGCTGTAAAAGTATCTCCAATAGTATCTGTCAACTTAGTTATCAGCATTATTGTT
    GGTATTGTTTTAGCAATATTGATTATTTTCTTAAAAGAATTATTAGATAAGCGTATTAAG
    ACAGAAGAAGATGTTGAATCGCAACTAGGATTACCTATTTTAGGTTCAATACAAAAATTT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_03000
  • symbol: SAOUHSC_03000
  • description: capsular polysaccharide biosynthesis protein CapA
  • length: 220
  • theoretical pI: 9.8166
  • theoretical MW: 24339.5
  • GRAVY: 0.299091

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids polysaccharide export protein, MPA1 family (TIGR01006; HMM-score: 240.8)
    and 4 more
    chain length determinant protein EpsF (TIGR03017; HMM-score: 55.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 41.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 29.4)
    NDMA-dependent methanol dehydrogenase (TIGR04266; EC 1.1.99.37; HMM-score: 15.4)
  • TheSEED:  
    Cell Wall and Capsule Capsular and extracellular polysacchrides Exopolysaccharide Biosynthesis  Tyrosine-protein kinase transmembrane modulator EpsC
    and 1 more
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Cell envelope-associated LytR-CpsA-Psr transcriptional attenuators  Tyrosine-protein kinase transmembrane modulator EpsC
  • PFAM:
    no clan defined Wzz; Chain length determinant protein (PF02706; HMM-score: 82.6)
    and 7 more
    GNVR; G-rich domain on putative tyrosine kinase (PF13807; HMM-score: 20.1)
    Amnionless; Amnionless (PF14828; HMM-score: 13.9)
    DUF2975; Protein of unknown function (DUF2975) (PF11188; HMM-score: 13.7)
    CD34_antigen; CD34/Podocalyxin family (PF06365; HMM-score: 12.6)
    VSA (CL0656) RIFIN; Rifin (PF02009; HMM-score: 11.1)
    FUSC (CL0307) FUSC; Fusaric acid resistance protein family (PF04632; HMM-score: 8.8)
    no clan defined DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 8.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.154438
    • TAT(Tat/SPI): 0.003094
    • LIPO(Sec/SPII): 0.028865
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSDLAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVSVTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIVGIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]