From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0053 [new locus tag: SAUSA300_RS00275 ]
  • pan locus tag?: SAUPAN000807000
  • symbol: speG
  • pan gene symbol?: speG
  • synonym:
  • product: spermidine N(1)-acetyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0053 [new locus tag: SAUSA300_RS00275 ]
  • symbol: speG
  • product: spermidine N(1)-acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 63100..63597
  • length: 498
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAACTAAGAGCATTAGAGTATAGTGATTTACTTTTTGTTCATGAATTAAATAATGAA
    TATTCTATTATGTCTTATTGGTTTGAAGAGCCTTATGAATCCTTAACGGAACTTCAACAT
    TTATTTGATAAGCATTTATTAGATGAATCGGAAAGACGTTTTATTGTTGAAGATGAAAAT
    CAAGTCGTAGGTATTGTTGAATTAGTAGAAATTAATTACATCCATCGTAATTGTGAAATA
    CAAATAATTATTAAACCTGAGTTCAGTGGTAAAGGTTATGCAAAATTCGCATTCGAAAAA
    GCGATAATTTATGCATTCAATATTTTAAATATGCACAAGATCTATCTATATGTTGATGCA
    GATAACAAAAAAGCTATTCATATATACGAGTCACAAGGATTTAAAACAGAAGGATTACTT
    AAAGAGCAATTCTACACTAAAGGTAAATATAAAGATGCCTATTTTATGTCATTATTGAAA
    TCTGAATATATTTTGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    498

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0053 [new locus tag: SAUSA300_RS00275 ]
  • symbol: SpeG
  • description: spermidine N(1)-acetyltransferase
  • length: 165
  • theoretical pI: 5.10639
  • theoretical MW: 19780.6
  • GRAVY: -0.270303

Function[edit | edit source]

  • reaction:
    EC 2.3.1.57?  ExPASy
    Diamine N-acetyltransferase Acetyl-CoA + an alkane-alpha,omega-diamine = CoA + an N-acetyldiamine
  • TIGRFAM:
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 72.5)
    and 3 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 47.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 27.6)
    Cellular processes Cellular processes Toxin production and resistance aminoglycoside N(6')-acetyltransferase, AacA4 family (TIGR04431; EC 2.3.1.82; HMM-score: 13.8)
  • TheSEED:  
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Polyamine Metabolism  Spermidine N1-acetyltransferase (EC 2.3.1.57)
    and 1 more
    Protein Metabolism Protein processing and modification Ribosomal protein S5p acylation  Spermidine N1-acetyltransferase (EC 2.3.1.57)
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 65.4)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 57.2)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 54.9)
    and 7 more
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 38.8)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 35.1)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 25.8)
    GNAT_acetyltran; GNAT acetyltransferase (PF12746; HMM-score: 22.2)
    FR47; FR47-like protein (PF08445; HMM-score: 20.6)
    Acetyltransf_15; Putative acetyl-transferase (PF17013; HMM-score: 16.9)
    no clan defined CBS; CBS domain (PF00571; HMM-score: 13.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001282
    • TAT(Tat/SPI): 0.000074
    • LIPO(Sec/SPII): 0.000139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLTELQHLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAIIYAFNILNMHKIYLYVDADNKKAIHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSLLKSEYIL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • speG no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]